(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE127

ACCPU_3.PE127        Location/Qualifiers
FT   CDS             complement(133718..134185)
FT                   /locus_tag="CAP2UW1_4703"
FT                   /gene_family="HOG000229131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091632"
FT                   /db_xref="GeneID:8402067"
FT                   /translation="MKKALFLIAAASAFALASPTLLAHTDEALDTQKAPNGGQLRMAGA
FT                   YHYELVVAKDSKEAKDNPVVVYVTDHAGTKVPTAGAKGTVTILSGKAKVTVSLIPDGDN
FT                   RLKGSGAYASAPDMKAIVSVTLPNKSPEQARFTPLDKPMLSTQDGHAGHSH"
FT                   /protein_id="YP_003165275.1"
     MKKALFLIAA ASAFALASPT LLAHTDEALD TQKAPNGGQL RMAGAYHYEL VVAKDSKEAK        60
     DNPVVVYVTD HAGTKVPTAG AKGTVTILSG KAKVTVSLIP DGDNRLKGSG AYASAPDMKA       120
     IVSVTLPNKS PEQARFTPLD KPMLSTQDGH AGHSH                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page