(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE128

ACCPU_3.PE128        Location/Qualifiers
FT   CDS             complement(134217..137321)
FT                   /locus_tag="CAP2UW1_4704"
FT                   /gene_family="HOG000126204" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091633"
FT                   /db_xref="GeneID:8402068"
FT                   /translation="MFDYIVHTALKQRLIVLGISLLLIIYGAITLRQMPVDVFPDLNKP
FT                   TVTLMTEAGGMAPEEVEQLVTFPVESSMNGMPGVTRVRSVSGIGLSIIYVEFEWGSDIY
FT                   RNRQQIAERLNLVREALPPGIVPQLGPISSIMGEILLIALPADPDKISPMTVREYADWV
FT                   MRPRLLTIPGVAQVIPIGGEVRQYRVEIKPAQLQALGIEREKLEAALKDFGANTSGGFL
FT                   EAQGREYLIRQIGRSSRIENLQNLVVATKNGQPILLRQVADVKLAPAVKRGDGSYKGKP
FT                   AVILSVQKQPAADSVQLTREVEKAMAELGKSLPKGFDTPSFLFKQADFIEHSVNNVEEA
FT                   LRDGAILVAVILFVFLLNVRTTLISLMAIPVSLLVTALVFHYFGLSINTMTLGGLAIAI
FT                   GELVDDAVVGVENVLRRLKLNRATDSPRPVAEVIAAATLEVRSAIVYATVIIVLVFVPL
FT                   FVLPGIEGRLFTPLGVAYIVSILASMIVSVTLTPVMAYYLLPQMKQLHAGDSPLVIWLK
FT                   RWDAKLLHWSFGHARRLLAGAAALVIIVAASVPFFPRSFLPPFNEGTLTVNVLLNPGTS
FT                   LAESNSIGTLAEQLVMQVPEVTQLGRRTGRAELDEHAEGVHYTEMDVDLKASARSREEI
FT                   IADIRQRLASLPAASNVGQPISHRLDHLLSGVRAQIALKIYGDDLDTLRGLAAEMRDRL
FT                   ARIPGVADLQIEKQVLIPQIKIRLDYEQAARYGVAPGSLLRGLEQMIEGEKITQIIEGN
FT                   RRFDLLVRLPESARGPQALADLLIETPTGYVPLSKIASVEESDGPNQVSRENSRRRIVL
FT                   SANTDGRDMSKVIADIRAELAAKPLPEGYFTALEGQFQAQEQAAKLITLLALVSLTMIF
FT                   MVLYSRYRSMALTLIIMGNIPLALIGSVIALWISGQPLSVAALVGFITLTGIATRNGIL
FT                   KISHYINLCAFEGETFGQHMIVRGSLERLTPVLMTALVAAFALMPLLLSADAPGKEVLH
FT                   PVAVVIFGGLISSTLLDTLLTPVMFWLWGQRPLDSLLASQEKESF"
FT                   /protein_id="YP_003165276.1"
     MFDYIVHTAL KQRLIVLGIS LLLIIYGAIT LRQMPVDVFP DLNKPTVTLM TEAGGMAPEE        60
     VEQLVTFPVE SSMNGMPGVT RVRSVSGIGL SIIYVEFEWG SDIYRNRQQI AERLNLVREA       120
     LPPGIVPQLG PISSIMGEIL LIALPADPDK ISPMTVREYA DWVMRPRLLT IPGVAQVIPI       180
     GGEVRQYRVE IKPAQLQALG IEREKLEAAL KDFGANTSGG FLEAQGREYL IRQIGRSSRI       240
     ENLQNLVVAT KNGQPILLRQ VADVKLAPAV KRGDGSYKGK PAVILSVQKQ PAADSVQLTR       300
     EVEKAMAELG KSLPKGFDTP SFLFKQADFI EHSVNNVEEA LRDGAILVAV ILFVFLLNVR       360
     TTLISLMAIP VSLLVTALVF HYFGLSINTM TLGGLAIAIG ELVDDAVVGV ENVLRRLKLN       420
     RATDSPRPVA EVIAAATLEV RSAIVYATVI IVLVFVPLFV LPGIEGRLFT PLGVAYIVSI       480
     LASMIVSVTL TPVMAYYLLP QMKQLHAGDS PLVIWLKRWD AKLLHWSFGH ARRLLAGAAA       540
     LVIIVAASVP FFPRSFLPPF NEGTLTVNVL LNPGTSLAES NSIGTLAEQL VMQVPEVTQL       600
     GRRTGRAELD EHAEGVHYTE MDVDLKASAR SREEIIADIR QRLASLPAAS NVGQPISHRL       660
     DHLLSGVRAQ IALKIYGDDL DTLRGLAAEM RDRLARIPGV ADLQIEKQVL IPQIKIRLDY       720
     EQAARYGVAP GSLLRGLEQM IEGEKITQII EGNRRFDLLV RLPESARGPQ ALADLLIETP       780
     TGYVPLSKIA SVEESDGPNQ VSRENSRRRI VLSANTDGRD MSKVIADIRA ELAAKPLPEG       840
     YFTALEGQFQ AQEQAAKLIT LLALVSLTMI FMVLYSRYRS MALTLIIMGN IPLALIGSVI       900
     ALWISGQPLS VAALVGFITL TGIATRNGIL KISHYINLCA FEGETFGQHM IVRGSLERLT       960
     PVLMTALVAA FALMPLLLSA DAPGKEVLHP VAVVIFGGLI SSTLLDTLLT PVMFWLWGQR      1020
     PLDSLLASQE KESF                                                        1034
//

If you have problems or comments...

PBIL Back to PBIL home page