(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE129

ACCPU_3.PE129        Location/Qualifiers
FT   CDS             complement(137323..138471)
FT                   /locus_tag="CAP2UW1_4705"
FT                   /gene_family="HOG000219675" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091634"
FT                   /db_xref="GeneID:8402069"
FT                   /translation="MRKIDLHVLVTALALSMVTEAALAHGDEDHSQDAKKKAPAAVSAV
FT                   GTTGVTAALQRLADGSLFVPKPVQRQLGLRTQPVRIAELAATVELNGQIIPDPETSGRV
FT                   QAMFAGSVIPGPKGMPTAGRKVAKGEVLVYLRPISGAIERGNQKASLAELEAQLAIAKG
FT                   KMKRFEQLEGAVPQKEIEAARIEHAALQQRRAYVRASIDSAEPLVAPAAGIISASHHLL
FT                   AGQVVDAKEVLFEIVDPARLAVEALAYDVGIAKTLVSASALADQTALDLKFVGGGQQLR
FT                   EQALPLLFRITNRNAAVAVGQPVKVFARTEQGVKGATAPRTALTQVGAGETAVWVHIEA
FT                   ERFVARRIRHQSLDAANVAILDGLHDGDRVVTVGAGLLSQVR"
FT                   /protein_id="YP_003165277.1"
     MRKIDLHVLV TALALSMVTE AALAHGDEDH SQDAKKKAPA AVSAVGTTGV TAALQRLADG        60
     SLFVPKPVQR QLGLRTQPVR IAELAATVEL NGQIIPDPET SGRVQAMFAG SVIPGPKGMP       120
     TAGRKVAKGE VLVYLRPISG AIERGNQKAS LAELEAQLAI AKGKMKRFEQ LEGAVPQKEI       180
     EAARIEHAAL QQRRAYVRAS IDSAEPLVAP AAGIISASHH LLAGQVVDAK EVLFEIVDPA       240
     RLAVEALAYD VGIAKTLVSA SALADQTALD LKFVGGGQQL REQALPLLFR ITNRNAAVAV       300
     GQPVKVFART EQGVKGATAP RTALTQVGAG ETAVWVHIEA ERFVARRIRH QSLDAANVAI       360
     LDGLHDGDRV VTVGAGLLSQ VR                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page