(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE130

ACCPU_3.PE130        Location/Qualifiers
FT   CDS             complement(138474..139019)
FT                   /locus_tag="CAP2UW1_4706"
FT                   /gene_family="HOG000158242" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091635"
FT                   /db_xref="GeneID:8402070"
FT                   /translation="MKHVKRFLLVTLVAFSLPVWAGGDSSDGHSHEAPAPLPVSQSVTP
FT                   RAVAATEEFEVVTSLEGKKLVVYVDRFASNEPVAQAKVEIEGAGLKGVASETTPGTYVL
FT                   DVATPLPPARHPLTISVEAGDSIDLLTTTLDTSGSVTTEVHTHGWREWVVWALPGALLL
FT                   ITGIWFAVRRHKRAKKGI"
FT                   /protein_id="YP_003165278.1"
     MKHVKRFLLV TLVAFSLPVW AGGDSSDGHS HEAPAPLPVS QSVTPRAVAA TEEFEVVTSL        60
     EGKKLVVYVD RFASNEPVAQ AKVEIEGAGL KGVASETTPG TYVLDVATPL PPARHPLTIS       120
     VEAGDSIDLL TTTLDTSGSV TTEVHTHGWR EWVVWALPGA LLLITGIWFA VRRHKRAKKG       180
     I                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page