(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE131

ACCPU_3.PE131        Location/Qualifiers
FT   CDS             complement(139016..140275)
FT                   /locus_tag="CAP2UW1_4707"
FT                   /gene_family="HOG000219673" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091636"
FT                   /db_xref="GeneID:8402071"
FT                   /translation="MKPVRFHQFRQLRRAAVCATVLLAGLSVHAAETPRSGLATAVEQA
FT                   WRLNPQAAGLDAREAEARAAQDVAAGLTPEPGSVSIGNLSDQFNRNQGKQEYEVELAVP
FT                   LWLPGQKAAREAEATSRIDEAVARRTAVRLEVSGELREAWWALAAARGAKVLASRRVET
FT                   ARALETDVMRRYKVGELSRIDANLALTETYVANAELVEAEANQLQAEQAVQALTGSPAP
FT                   KNLDEESPTTRPLADETGDSAASHPLLAVTAAAARSARARVKVADESRRAAPELTLRVV
FT                   RERDDFADSYSNNVGIKLKIPFSSGSQVRRETSAAQAEANQSDADLLRTHTRVRLDAER
FT                   AQRNLQSAERQFAMAQERRQLSAENLRLAEKAFALGESDLATLLRIRSAAFDADAFFDR
FT                   QRVARAAAVSRLNQALGVLP"
FT                   /protein_id="YP_003165279.1"
     MKPVRFHQFR QLRRAAVCAT VLLAGLSVHA AETPRSGLAT AVEQAWRLNP QAAGLDAREA        60
     EARAAQDVAA GLTPEPGSVS IGNLSDQFNR NQGKQEYEVE LAVPLWLPGQ KAAREAEATS       120
     RIDEAVARRT AVRLEVSGEL REAWWALAAA RGAKVLASRR VETARALETD VMRRYKVGEL       180
     SRIDANLALT ETYVANAELV EAEANQLQAE QAVQALTGSP APKNLDEESP TTRPLADETG       240
     DSAASHPLLA VTAAAARSAR ARVKVADESR RAAPELTLRV VRERDDFADS YSNNVGIKLK       300
     IPFSSGSQVR RETSAAQAEA NQSDADLLRT HTRVRLDAER AQRNLQSAER QFAMAQERRQ       360
     LSAENLRLAE KAFALGESDL ATLLRIRSAA FDADAFFDRQ RVARAAAVSR LNQALGVLP        419
//

If you have problems or comments...

PBIL Back to PBIL home page