(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE132

ACCPU_3.PE132        Location/Qualifiers
FT   CDS             140495..141172
FT                   /locus_tag="CAP2UW1_4708"
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091637"
FT                   /db_xref="GeneID:8402072"
FT                   /translation="MKILVVEDEIKTGDYLRQGLTEAGFVVDLARDGLDGLHLAQTDAY
FT                   DLAILDVMLPGIDGWAVLQGIRRAGKDMPVLFLTARDQVQDRVHGLELGADDYMVKPFA
FT                   FAELLARVRIHLRRGSKTKESEYLRAADLELDLMRRRVTRAGRRIDLTVKEFALLELLL
FT                   RRQGEVLPRSLIASQVWDMNFDSDTNVIEVAIKRLRLKIDEDFELKLIRTVRGMGYVLE
FT                   IAE"
FT                   /protein_id="YP_003165280.1"
     MKILVVEDEI KTGDYLRQGL TEAGFVVDLA RDGLDGLHLA QTDAYDLAIL DVMLPGIDGW        60
     AVLQGIRRAG KDMPVLFLTA RDQVQDRVHG LELGADDYMV KPFAFAELLA RVRIHLRRGS       120
     KTKESEYLRA ADLELDLMRR RVTRAGRRID LTVKEFALLE LLLRRQGEVL PRSLIASQVW       180
     DMNFDSDTNV IEVAIKRLRL KIDEDFELKL IRTVRGMGYV LEIAE                       225
//

If you have problems or comments...

PBIL Back to PBIL home page