(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE133

ACCPU_3.PE133        Location/Qualifiers
FT   CDS             141169..142557
FT                   /locus_tag="CAP2UW1_4709"
FT                   /gene_family="HOG000126763" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091638"
FT                   /db_xref="GeneID:8402073"
FT                   /translation="MKSAGRKSIIFRLTLLFASASTAVLLVLGLLIGNSVEHHFEVQDM
FT                   EVLTGKLELTRHALEKVHSQSDLDALPQQLDDSLVGHHGLAVIVVAPSGQTLFVTSGAE
FT                   FPQVLLARSPDMTNSGPIIWKSTDHIPLRGISAMVKTGIEGAKPAVVAVATDISKHEHF
FT                   MSWFRFTLWSVVILAALMTGFLGWVAVRRGLAPLHAIKLEAAAITADRLHSRLATESIP
FT                   IELVDLAETLNQMLARLEDSFRRLSDFSSDIAHELRTPVSNLLTQTQVMLLRVRTIDEY
FT                   QDVLASNAEELERMAKMIADMLFLAKADNNLVVPNLEAVDLRAEAEGLASFYEAVAEEN
FT                   SVALTVDGSATVTGDRLMLRRAIGNLLSNAFGHTPRGGYVRIQIGKNEDRMATIQVENS
FT                   GETISPEHLPRLFDRFYRADPSRKRLADGVGLGLALTRSIIQAHGGSVSVRSADGVTIF
FT                   ELQM"
FT                   /protein_id="YP_003165281.1"
     MKSAGRKSII FRLTLLFASA STAVLLVLGL LIGNSVEHHF EVQDMEVLTG KLELTRHALE        60
     KVHSQSDLDA LPQQLDDSLV GHHGLAVIVV APSGQTLFVT SGAEFPQVLL ARSPDMTNSG       120
     PIIWKSTDHI PLRGISAMVK TGIEGAKPAV VAVATDISKH EHFMSWFRFT LWSVVILAAL       180
     MTGFLGWVAV RRGLAPLHAI KLEAAAITAD RLHSRLATES IPIELVDLAE TLNQMLARLE       240
     DSFRRLSDFS SDIAHELRTP VSNLLTQTQV MLLRVRTIDE YQDVLASNAE ELERMAKMIA       300
     DMLFLAKADN NLVVPNLEAV DLRAEAEGLA SFYEAVAEEN SVALTVDGSA TVTGDRLMLR       360
     RAIGNLLSNA FGHTPRGGYV RIQIGKNEDR MATIQVENSG ETISPEHLPR LFDRFYRADP       420
     SRKRLADGVG LGLALTRSII QAHGGSVSVR SADGVTIFEL QM                          462
//

If you have problems or comments...

PBIL Back to PBIL home page