(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE134

ACCPU_3.PE134        Location/Qualifiers
FT   CDS             complement(142814..143113)
FT                   /locus_tag="CAP2UW1_4710"
FT                   /gene_family="HOG000229130" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091639"
FT                   /db_xref="GeneID:8402074"
FT                   /translation="MKTKLAKLALIAVLSTSGATTAFADDAARAEAKQVVDLKNGATLY
FT                   IFNDGKMAIEDRYGRATRTTPGTEVETSDGRKITTQSDEVARLNSLINKGHKGG"
FT                   /protein_id="YP_003165282.1"
     MKTKLAKLAL IAVLSTSGAT TAFADDAARA EAKQVVDLKN GATLYIFNDG KMAIEDRYGR        60
     ATRTTPGTEV ETSDGRKITT QSDEVARLNS LINKGHKGG                               99
//

If you have problems or comments...

PBIL Back to PBIL home page