(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE135

ACCPU_3.PE135        Location/Qualifiers
FT   CDS             complement(143240..143563)
FT                   /locus_tag="CAP2UW1_4711"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091640"
FT                   /db_xref="GeneID:8402075"
FT                   /translation="MGNRRGRASPAGSDGKQSFTFFGPPAATDPYAKLSIRVALHNDPL
FT                   LPDDVYKLFGGFLIRKLTDTVTWAPAAARPELTLNLRSQSVSNEVGMLSFNGDSFSHLN
FT                   KTS"
FT                   /protein_id="YP_003165283.1"
     MGNRRGRASP AGSDGKQSFT FFGPPAATDP YAKLSIRVAL HNDPLLPDDV YKLFGGFLIR        60
     KLTDTVTWAP AAARPELTLN LRSQSVSNEV GMLSFNGDSF SHLNKTS                     107
//

If you have problems or comments...

PBIL Back to PBIL home page