(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE136

ACCPU_3.PE136        Location/Qualifiers
FT   CDS             144197..144508
FT                   /locus_tag="CAP2UW1_4713"
FT                   /gene_family="HOG000043828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091641"
FT                   /db_xref="GeneID:8402106"
FT                   /translation="MTRSDLITVLASRFPSLVAKDAEIAVKEILDAIGIALAQGDRVEI
FT                   RGFGSFRLNYRPARTGRNPKSGEPVAVAEKYVPHFQASKEMRERVEQSVKPAPLQRAA"
FT                   /protein_id="YP_003165284.1"
     MTRSDLITVL ASRFPSLVAK DAEIAVKEIL DAIGIALAQG DRVEIRGFGS FRLNYRPART        60
     GRNPKSGEPV AVAEKYVPHF QASKEMRERV EQSVKPAPLQ RAA                         103
//

If you have problems or comments...

PBIL Back to PBIL home page