(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE137

ACCPU_3.PE137        Location/Qualifiers
FT   CDS             complement(145042..148008)
FT                   /locus_tag="CAP2UW1_4715"
FT                   /gene_family="HOG000098781" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091642"
FT                   /db_xref="GeneID:8402107"
FT                   /translation="MPRRSILSAAERESLLALPDTKDDLIRHYSLSDSDLSIIRQRRGP
FT                   ANRLGFAVQLCYLRFPGILLGVDQPLFLPLLKLVADQLKVGVESWNDYGQREQTRREHL
FT                   VELQTVFGFQPFTMSHYRQAVHTLTELAMQTDKGIVLASALIEQLRRQSIILPALNAIE
FT                   RASAEAITRANRRIYEALSEPLSNGHRHRLDDLLKRRDNGKMTWLAWLRQSPVKPNSRH
FT                   MLEHIERLKAWQALDLPSGIERLVHQNRLLKIAREGGQMTPADLAKFEPRRRYATLVAL
FT                   AIEGMATVTDEIIDLHDRILGKLFNAAKNKHQQQFQASGKAINAKVRLYGRIGQALIDA
FT                   KQSGRDPFAAIEAVMSWDAFAESVTEAQKLAQPDDFDFLHRIGESYATLRRYAPEFLAV
FT                   LKLRAAPAAKGVLDAIEVLRGMNTDNARKVPTDAPTDFIKPRWQKLVMTDAGIDRRYYE
FT                   LCALSELKNSLRSGDIWVQGSRQFKDFEDYLVPPDKFTSLKQSSTLPLAVVTDCDQYLH
FT                   DRLTLLETQLATVNRMAAANDLPDAIITESGLKITPLDAAVPDTAQALIDQTAMILPHV
FT                   KITELLLEVDEWTGFTRHFTHLKSGDLAKDKNLLLTTILADAINLGLTKMAESCPGTTY
FT                   AKLAWLQAWHTRDETYSTALAELVNAQFRHPFAEHWGDGTTSSSDGQNFRTGSKAESTG
FT                   HINPKYGSSPGRTFYTHISDQYAPFHTKVVNVGVRDSTYVLDGLLYHESDLRIEEHYTD
FT                   TAGFTDHVFALMHLLGFRFAPRIRDLGDTKLYISKGETAYDALKPMIGGTLNIKHVRAH
FT                   WDEILRLATSIKQGTVTASLMLRKLGSYPRQNGLAVALRELGRIERTLFILDWLQSVEL
FT                   RRRVHAGLNKGEARNALARAVFFNRLGEIRDRSFEQQRYRASGLNLVTAAVVLWNTVYL
FT                   ERAAQALRGNGHTVDNALLQYLSPLGWEHINLTGDYLWRSSAKIGAGKFRPLRPLQPA"
FT                   /protein_id="YP_003165285.1"
     MPRRSILSAA ERESLLALPD TKDDLIRHYS LSDSDLSIIR QRRGPANRLG FAVQLCYLRF        60
     PGILLGVDQP LFLPLLKLVA DQLKVGVESW NDYGQREQTR REHLVELQTV FGFQPFTMSH       120
     YRQAVHTLTE LAMQTDKGIV LASALIEQLR RQSIILPALN AIERASAEAI TRANRRIYEA       180
     LSEPLSNGHR HRLDDLLKRR DNGKMTWLAW LRQSPVKPNS RHMLEHIERL KAWQALDLPS       240
     GIERLVHQNR LLKIAREGGQ MTPADLAKFE PRRRYATLVA LAIEGMATVT DEIIDLHDRI       300
     LGKLFNAAKN KHQQQFQASG KAINAKVRLY GRIGQALIDA KQSGRDPFAA IEAVMSWDAF       360
     AESVTEAQKL AQPDDFDFLH RIGESYATLR RYAPEFLAVL KLRAAPAAKG VLDAIEVLRG       420
     MNTDNARKVP TDAPTDFIKP RWQKLVMTDA GIDRRYYELC ALSELKNSLR SGDIWVQGSR       480
     QFKDFEDYLV PPDKFTSLKQ SSTLPLAVVT DCDQYLHDRL TLLETQLATV NRMAAANDLP       540
     DAIITESGLK ITPLDAAVPD TAQALIDQTA MILPHVKITE LLLEVDEWTG FTRHFTHLKS       600
     GDLAKDKNLL LTTILADAIN LGLTKMAESC PGTTYAKLAW LQAWHTRDET YSTALAELVN       660
     AQFRHPFAEH WGDGTTSSSD GQNFRTGSKA ESTGHINPKY GSSPGRTFYT HISDQYAPFH       720
     TKVVNVGVRD STYVLDGLLY HESDLRIEEH YTDTAGFTDH VFALMHLLGF RFAPRIRDLG       780
     DTKLYISKGE TAYDALKPMI GGTLNIKHVR AHWDEILRLA TSIKQGTVTA SLMLRKLGSY       840
     PRQNGLAVAL RELGRIERTL FILDWLQSVE LRRRVHAGLN KGEARNALAR AVFFNRLGEI       900
     RDRSFEQQRY RASGLNLVTA AVVLWNTVYL ERAAQALRGN GHTVDNALLQ YLSPLGWEHI       960
     NLTGDYLWRS SAKIGAGKFR PLRPLQPA                                          988
//

If you have problems or comments...

PBIL Back to PBIL home page