(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE138

ACCPU_3.PE138        Location/Qualifiers
FT   CDS             complement(148011..148571)
FT                   /locus_tag="CAP2UW1_4716"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091643"
FT                   /db_xref="GeneID:8402078"
FT                   /translation="MKGQRIGYVRVSSFDQNPDRQLEQVQVDKVFTDKASGKDTLRPQL
FT                   DTLLTFVREGDTVVVHSMDRLARNLDDLRRLVQKLTKRGVRIEFVKECLTFTGEDSPMA
FT                   NLMLSVMGAFAEFERALIRERQREGIALAKQRGAYRGRKKALSPERAAELRQRADAGEQ
FT                   KSKLAREFGVSRETLYQYLRTDQ"
FT                   /protein_id="YP_003165286.1"
     MKGQRIGYVR VSSFDQNPDR QLEQVQVDKV FTDKASGKDT LRPQLDTLLT FVREGDTVVV        60
     HSMDRLARNL DDLRRLVQKL TKRGVRIEFV KECLTFTGED SPMANLMLSV MGAFAEFERA       120
     LIRERQREGI ALAKQRGAYR GRKKALSPER AAELRQRADA GEQKSKLARE FGVSRETLYQ       180
     YLRTDQ                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page