(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE139

ACCPU_3.PE139        Location/Qualifiers
FT   CDS             complement(148701..149780)
FT                   /locus_tag="CAP2UW1_4717"
FT                   /gene_family="HOG000002872" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091644"
FT                   /db_xref="GeneID:8402079"
FT                   /translation="MSWKFFLYDWGGLNIALFQAINMSTPAALEPPVSFFNLVIGNYWT
FT                   APLMLLAMWGWSKSAPDPTRADAIRYRLRVFSVAFALAFLVATILKLWIDFPRPPAVFG
FT                   DMVRVIGGIERHYSLPSGHATYAALVVGALWPLIGRRGRIGLVLYAALVGWSRIAAGMH
FT                   FPADVLAGWVLGLSCTALAGWLMPLAAPVWQSARRTSTWVWFAVAASSVMTDQLAKFAI
FT                   TRTFAYGEQVEVSTFFNIVHVLNPGAAFSFLANAGGWQRYFLMALGLVVSAWLGRMLCQ
FT                   QRPRLEAVGYSLILGGALGNVVDRVLRGSVVDFLDFHWQLVHWPAFNLADVAITIGALC
FT                   LFLTVVPKSSRGTEADVSG"
FT                   /protein_id="YP_003165287.1"
     MSWKFFLYDW GGLNIALFQA INMSTPAALE PPVSFFNLVI GNYWTAPLML LAMWGWSKSA        60
     PDPTRADAIR YRLRVFSVAF ALAFLVATIL KLWIDFPRPP AVFGDMVRVI GGIERHYSLP       120
     SGHATYAALV VGALWPLIGR RGRIGLVLYA ALVGWSRIAA GMHFPADVLA GWVLGLSCTA       180
     LAGWLMPLAA PVWQSARRTS TWVWFAVAAS SVMTDQLAKF AITRTFAYGE QVEVSTFFNI       240
     VHVLNPGAAF SFLANAGGWQ RYFLMALGLV VSAWLGRMLC QQRPRLEAVG YSLILGGALG       300
     NVVDRVLRGS VVDFLDFHWQ LVHWPAFNLA DVAITIGALC LFLTVVPKSS RGTEADVSG        359
//

If you have problems or comments...

PBIL Back to PBIL home page