(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE14

ACCPU_3.PE14         Location/Qualifiers
FT   CDS             complement(12467..13042)
FT                   /locus_tag="CAP2UW1_4582"
FT                   /gene_family="HOG000119699" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091519"
FT                   /db_xref="GeneID:8401954"
FT                   /translation="MRGLSPRNMKYMPAFAEAWPESEWYIRKTTENGWSRSVLELQIET
FT                   AAHRRVGAAQTNFDRALPSPQSDLARDILKDSYTFDFLGITDASNERTIEKALVLRLRD
FT                   FLIELGVGSAFVGSQNRLEVDGRNGCARLVVLPYSISHGSPISILGSSLCAMYGEAVLR
FT                   ASCHAGWPTLGGVPGRSLGYGKFPRALP"
FT                   /protein_id="YP_003165162.1"
     MRGLSPRNMK YMPAFAEAWP ESEWYIRKTT ENGWSRSVLE LQIETAAHRR VGAAQTNFDR        60
     ALPSPQSDLA RDILKDSYTF DFLGITDASN ERTIEKALVL RLRDFLIELG VGSAFVGSQN       120
     RLEVDGRNGC ARLVVLPYSI SHGSPISILG SSLCAMYGEA VLRASCHAGW PTLGGVPGRS       180
     LGYGKFPRAL P                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page