(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE140

ACCPU_3.PE140        Location/Qualifiers
FT   CDS             complement(149777..152182)
FT                   /locus_tag="CAP2UW1_4718"
FT                   /gene_family="HOG000250399" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091645"
FT                   /db_xref="GeneID:8402080"
FT                   /translation="MSECASTACGCSAGPIIQPTTQAPATTGSAQAVYRIENMDCPTEE
FT                   ALIRGKLVGLAGVVGLEFNLMQRTLAVRHELPSLFPVEQALTAIGMQAVRMDQASTGQT
FT                   TKLSITKMDCPTEETLIRNKLGTMAGVADLDFNLMQRTLSVRHADQVLPDVLAALQALG
FT                   FEAQVLDTAEAASPSASLVTTPTNWWPLGISFVTASAAEAVYWLHNGNHWSVVVLALVA
FT                   VFTGGLSTYKKGWIALKNRNLNMNALMSIAVTGAMLIGHWPEAAMVMVLFALAEVIEAK
FT                   SLDRARNAIRGLLDLTPEQATVQQADGTWREVGAKQIAIGSRVRVKPGERIALDGEVLE
FT                   GRSAVNQAPITGESLPVEKSPGDPVFAGTINESGSFEYRVTAVASNSTLARIIHAVEAA
FT                   QGSRAPTQRFVDQFARWYTPIVFGVAIAVALLPPLFMGAAWLDWIYRALVLLVVACPCA
FT                   LVISTPVSIVSGLAAAARHGILIKGGVYLEEGRKLRWLALDKTGTITHGKPAQTDFVTW
FT                   GNALAANSRSIAASLAARSDHPVSKAVAQAAQTDGVALLDVAEFSALPGRGVQGQINGE
FT                   TYHLGNQRMLEALGQCTPELEQRIAALETMGKTVVMLVSAKGVHALFAVADTIKESSRS
FT                   AIAELHALGINTMMLTGDNPHTAQAIAAQAGIDSAQGNLLPDDKLREVELLAIKGKVGM
FT                   VGDGINDAPALARADIGFAMGAAGTDTAIETADVALMDDNLGKIPTFVRLSRATAQVLM
FT                   QNIVLALGIKAVFLVLTFTGQATMWMAVFADMGASLLVVGNGLRLLRK"
FT                   /protein_id="YP_003165288.1"
     MSECASTACG CSAGPIIQPT TQAPATTGSA QAVYRIENMD CPTEEALIRG KLVGLAGVVG        60
     LEFNLMQRTL AVRHELPSLF PVEQALTAIG MQAVRMDQAS TGQTTKLSIT KMDCPTEETL       120
     IRNKLGTMAG VADLDFNLMQ RTLSVRHADQ VLPDVLAALQ ALGFEAQVLD TAEAASPSAS       180
     LVTTPTNWWP LGISFVTASA AEAVYWLHNG NHWSVVVLAL VAVFTGGLST YKKGWIALKN       240
     RNLNMNALMS IAVTGAMLIG HWPEAAMVMV LFALAEVIEA KSLDRARNAI RGLLDLTPEQ       300
     ATVQQADGTW REVGAKQIAI GSRVRVKPGE RIALDGEVLE GRSAVNQAPI TGESLPVEKS       360
     PGDPVFAGTI NESGSFEYRV TAVASNSTLA RIIHAVEAAQ GSRAPTQRFV DQFARWYTPI       420
     VFGVAIAVAL LPPLFMGAAW LDWIYRALVL LVVACPCALV ISTPVSIVSG LAAAARHGIL       480
     IKGGVYLEEG RKLRWLALDK TGTITHGKPA QTDFVTWGNA LAANSRSIAA SLAARSDHPV       540
     SKAVAQAAQT DGVALLDVAE FSALPGRGVQ GQINGETYHL GNQRMLEALG QCTPELEQRI       600
     AALETMGKTV VMLVSAKGVH ALFAVADTIK ESSRSAIAEL HALGINTMML TGDNPHTAQA       660
     IAAQAGIDSA QGNLLPDDKL REVELLAIKG KVGMVGDGIN DAPALARADI GFAMGAAGTD       720
     TAIETADVAL MDDNLGKIPT FVRLSRATAQ VLMQNIVLAL GIKAVFLVLT FTGQATMWMA       780
     VFADMGASLL VVGNGLRLLR K                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page