(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE141

ACCPU_3.PE141        Location/Qualifiers
FT   CDS             152266..152706
FT                   /locus_tag="CAP2UW1_4719"
FT                   /gene_family="HOG000266084" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091646"
FT                   /db_xref="GeneID:8402081"
FT                   /translation="MEIRIGDLAKRSGCEVVTIRYYEKEGLLPKPARSGGNFRLYGEAH
FT                   IERLQFIRHCRSLDMTLSEIRALLGLRDNPMQDCGEVNTLLEAHIQQVEMRVSALLQLK
FT                   RHLVDLREKCSGSRSVEACGILQGLGNCNCHGESATKSQTSG"
FT                   /protein_id="YP_003165289.1"
     MEIRIGDLAK RSGCEVVTIR YYEKEGLLPK PARSGGNFRL YGEAHIERLQ FIRHCRSLDM        60
     TLSEIRALLG LRDNPMQDCG EVNTLLEAHI QQVEMRVSAL LQLKRHLVDL REKCSGSRSV       120
     EACGILQGLG NCNCHGESAT KSQTSG                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page