(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE142

ACCPU_3.PE142        Location/Qualifiers
FT   CDS             complement(152725..152988)
FT                   /locus_tag="CAP2UW1_4720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091647"
FT                   /db_xref="GeneID:8402082"
FT                   /translation="MPVADLPPQLQERVVCSIAAAVKYQVPANIVFAVAEKEGGKPGQW
FT                   VRNSNGTHDVGPMQFNTAYLRDLARYGITPDDVAGVASENGK"
FT                   /protein_id="YP_003165290.1"
     MPVADLPPQL QERVVCSIAA AVKYQVPANI VFAVAEKEGG KPGQWVRNSN GTHDVGPMQF        60
     NTAYLRDLAR YGITPDDVAG VASENGK                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page