(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE143

ACCPU_3.PE143        Location/Qualifiers
FT   CDS             complement(153007..153591)
FT                   /locus_tag="CAP2UW1_4721"
FT                   /gene_family="HOG000229814" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbM"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091648"
FT                   /db_xref="GeneID:8402083"
FT                   /translation="MKNHCVFAPFILAIAAATAASAGAQEVLTGDTRLACEATLCLATS
FT                   TRPSECSPSLSRYFSIHKRKWSDTVRARANFLSLCPVSDQTPEMRSLVNAMANGAGRCD
FT                   AASLNVTLLVWNSWDADGGRVLINNQMPGYCAAYTGHQYTDLGDLAPRYVGTPERGGYW
FT                   VDARDYNAAVARYNDRIAAEDSRRRNEEWYR"
FT                   /protein_id="YP_003165291.1"
     MKNHCVFAPF ILAIAAATAA SAGAQEVLTG DTRLACEATL CLATSTRPSE CSPSLSRYFS        60
     IHKRKWSDTV RARANFLSLC PVSDQTPEMR SLVNAMANGA GRCDAASLNV TLLVWNSWDA       120
     DGGRVLINNQ MPGYCAAYTG HQYTDLGDLA PRYVGTPERG GYWVDARDYN AAVARYNDRI       180
     AAEDSRRRNE EWYR                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page