(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE144

ACCPU_3.PE144        Location/Qualifiers
FT   CDS             complement(153606..155132)
FT                   /locus_tag="CAP2UW1_4722"
FT                   /gene_family="HOG000219249" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091649"
FT                   /db_xref="GeneID:8402084"
FT                   /translation="MSLPTVLKSASITMLLWLAFFSIDAQAAINNAGVLDNVLARYAAA
FT                   ASAWAGVITARASFLFWTLAVISMVWTFGMLALRKADLGDFYAEFFRFTVFTGFFWWLL
FT                   TNGPRFATDIMDSLRTLGGMATGTGATLTPSGIVDIGFDIFFKVLDKSSILSPVDSAVG
FT                   ILISAAILIILALIGVNMLVLLVSGWILSYAGVFFLGFGGSRWTSDMAIGYYKTVLNIA
FT                   AQLFTMVLLVGIGKSFVDQYYAGMDPGISLKELGVMLIVAVVLFALVTKLPSLIGGLAM
FT                   GGSVHTMGSGLGTGAAMAAVGMASAAVGVAGAAIATGAASMAGGTQALMAACSKASQDV
FT                   AGGSDMLASLAGGSSSGAGRSSAGSGASPLAAAMDSSSAGGGPSGGSSSHSGRSDTRQA
FT                   SAKRGGTPGQAQSGDMASVVAKVGKVVAGTAANLAQGSWDVAKARAGEVKDAAMDRIGE
FT                   TTGGKIAAAIKARSDQQPAFGSDSLAKADDQSVDAEAEIAAFRDRAARSS"
FT                   /protein_id="YP_003165292.1"
     MSLPTVLKSA SITMLLWLAF FSIDAQAAIN NAGVLDNVLA RYAAAASAWA GVITARASFL        60
     FWTLAVISMV WTFGMLALRK ADLGDFYAEF FRFTVFTGFF WWLLTNGPRF ATDIMDSLRT       120
     LGGMATGTGA TLTPSGIVDI GFDIFFKVLD KSSILSPVDS AVGILISAAI LIILALIGVN       180
     MLVLLVSGWI LSYAGVFFLG FGGSRWTSDM AIGYYKTVLN IAAQLFTMVL LVGIGKSFVD       240
     QYYAGMDPGI SLKELGVMLI VAVVLFALVT KLPSLIGGLA MGGSVHTMGS GLGTGAAMAA       300
     VGMASAAVGV AGAAIATGAA SMAGGTQALM AACSKASQDV AGGSDMLASL AGGSSSGAGR       360
     SSAGSGASPL AAAMDSSSAG GGPSGGSSSH SGRSDTRQAS AKRGGTPGQA QSGDMASVVA       420
     KVGKVVAGTA ANLAQGSWDV AKARAGEVKD AAMDRIGETT GGKIAAAIKA RSDQQPAFGS       480
     DSLAKADDQS VDAEAEIAAF RDRAARSS                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page