(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE145

ACCPU_3.PE145        Location/Qualifiers
FT   CDS             complement(155141..155368)
FT                   /locus_tag="CAP2UW1_4723"
FT                   /gene_family="HOG000139295" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091650"
FT                   /db_xref="GeneID:8402085"
FT                   /translation="MITNRPALLTLAALVSSLISACSPETPKKEVPAVNDENCKWENML
FT                   KIEDKGTREQFASACARRGPGFTPSPKKEW"
FT                   /protein_id="YP_003165293.1"
     MITNRPALLT LAALVSSLIS ACSPETPKKE VPAVNDENCK WENMLKIEDK GTREQFASAC        60
     ARRGPGFTPS PKKEW                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page