(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE146

ACCPU_3.PE146        Location/Qualifiers
FT   CDS             complement(155384..156187)
FT                   /locus_tag="CAP2UW1_4724"
FT                   /gene_family="HOG000219250" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbJ"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091651"
FT                   /db_xref="GeneID:8402086"
FT                   /translation="MKVLTSKPAATKLTATGTLLRALLLALFAGPAMTTPTHAAGIPVI
FT                   DTANLSQTVISSIEAVAQTLKQIQQYQTQLQQYENMLQNTLAPAAYIWDSATSTMNQLR
FT                   SAIDTLNYYKTNLGSIDAYLGKFQDASYYRGSPCFRQGGCTDAEWAAIKENQRLGSEAQ
FT                   KRATDALFRGLDKQQAALEADAMTLQRLQASAQGATGQMQAISYANQLASQQANQLLQI
FT                   RALLVAEQNAIATRNQVLADREAQQAAAGEQLRQGSYVASPVRNW"
FT                   /protein_id="YP_003165294.1"
     MKVLTSKPAA TKLTATGTLL RALLLALFAG PAMTTPTHAA GIPVIDTANL SQTVISSIEA        60
     VAQTLKQIQQ YQTQLQQYEN MLQNTLAPAA YIWDSATSTM NQLRSAIDTL NYYKTNLGSI       120
     DAYLGKFQDA SYYRGSPCFR QGGCTDAEWA AIKENQRLGS EAQKRATDAL FRGLDKQQAA       180
     LEADAMTLQR LQASAQGATG QMQAISYANQ LASQQANQLL QIRALLVAEQ NAIATRNQVL       240
     ADREAQQAAA GEQLRQGSYV ASPVRNW                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page