(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE147

ACCPU_3.PE147        Location/Qualifiers
FT   CDS             complement(156206..157657)
FT                   /locus_tag="CAP2UW1_4725"
FT                   /gene_family="HOG000289491" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbI"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091652"
FT                   /db_xref="GeneID:8402087"
FT                   /translation="MVDQVTEDQMSPEASPGELSRKSGVRRVNNLPVYLVGGVMTVFLA
FT                   IMVLVAADRNAQQNKPNGGPKEKGGNTRLFASEIAGEQKDGIIPPAAAKPLQVPELSPP
FT                   ATTDGAVLIARPDNLDTPPKPPTSAGGGTPQSSSRDEELNRIRMAKMQQLEEAVKAKTT
FT                   VQMVAPRSAGSAPGAAGYAGAPGSREETLARLAALRQQSEAAVHDDPTAAYKARLATLQ
FT                   GAGIGGGGSGAASSSPQLLPSAAAGGRNNVAQFGNGSSGGSSGSSSGDQGDRWKLDSRM
FT                   EAPRSPFELRAGFVIPGTLISGINSQLPGQIMAQVAQNVYDTPTGKHLLIPQGSRLVGR
FT                   YSSDVAYGQARVLVAWQRIVFPDGKAIDIGAMPGADGVGYAGLTDQVNNHYLRLFGSAL
FT                   LMSAVTAGITYSQGQNQGNSVYGAPTASSAMSEALGQQLGQVTAQLIAKNMNIAPTLEI
FT                   RPGYRFNVIVARDMTFSKPYQSFDY"
FT                   /protein_id="YP_003165295.1"
     MVDQVTEDQM SPEASPGELS RKSGVRRVNN LPVYLVGGVM TVFLAIMVLV AADRNAQQNK        60
     PNGGPKEKGG NTRLFASEIA GEQKDGIIPP AAAKPLQVPE LSPPATTDGA VLIARPDNLD       120
     TPPKPPTSAG GGTPQSSSRD EELNRIRMAK MQQLEEAVKA KTTVQMVAPR SAGSAPGAAG       180
     YAGAPGSREE TLARLAALRQ QSEAAVHDDP TAAYKARLAT LQGAGIGGGG SGAASSSPQL       240
     LPSAAAGGRN NVAQFGNGSS GGSSGSSSGD QGDRWKLDSR MEAPRSPFEL RAGFVIPGTL       300
     ISGINSQLPG QIMAQVAQNV YDTPTGKHLL IPQGSRLVGR YSSDVAYGQA RVLVAWQRIV       360
     FPDGKAIDIG AMPGADGVGY AGLTDQVNNH YLRLFGSALL MSAVTAGITY SQGQNQGNSV       420
     YGAPTASSAM SEALGQQLGQ VTAQLIAKNM NIAPTLEIRP GYRFNVIVAR DMTFSKPYQS       480
     FDY                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page