(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE148

ACCPU_3.PE148        Location/Qualifiers
FT   CDS             complement(157664..158125)
FT                   /locus_tag="CAP2UW1_4726"
FT                   /gene_family="HOG000229816" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbH"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091653"
FT                   /db_xref="GeneID:8402088"
FT                   /translation="MRQFALSALLVMALAGCASTAPYGNFATEPPAGLEERIATDTVKQ
FT                   LVTLYPPARTRFHLGQPTPDAYGSALVEALRAKGYALVEFKPGTAPQAGSPEAAAATAP
FT                   GLNLHYLLDTAASPNLYRITVMVGQQSLSRAYLAQNDRVAPAGAWVRKE"
FT                   /protein_id="YP_003165296.1"
     MRQFALSALL VMALAGCAST APYGNFATEP PAGLEERIAT DTVKQLVTLY PPARTRFHLG        60
     QPTPDAYGSA LVEALRAKGY ALVEFKPGTA PQAGSPEAAA ATAPGLNLHY LLDTAASPNL       120
     YRITVMVGQQ SLSRAYLAQN DRVAPAGAWV RKE                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page