(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE15

ACCPU_3.PE15         Location/Qualifiers
FT   CDS             13310..13576
FT                   /locus_tag="CAP2UW1_4583"
FT                   /gene_family="HOG000100497" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091520"
FT                   /db_xref="GeneID:8401955"
FT                   /translation="MRTTKTLSITLPPEMLARAAEIARREHRTMSELVREALRDYERKN
FT                   WWSEMNAFGQAKAAELGLTEADVDQAVHEVRRERAGRGPETKV"
FT                   /protein_id="YP_003165163.1"
     MRTTKTLSIT LPPEMLARAA EIARREHRTM SELVREALRD YERKNWWSEM NAFGQAKAAE        60
     LGLTEADVDQ AVHEVRRERA GRGPETKV                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page