(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE150

ACCPU_3.PE150        Location/Qualifiers
FT   CDS             complement(159802..162360)
FT                   /locus_tag="CAP2UW1_4729"
FT                   /gene_family="HOG000289436" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbE"
FT                   /transl_table="11"
FT                   /note="type IV secretion system ATPase VirB4 family"
FT                   /db_xref="GI:257091655"
FT                   /db_xref="GeneID:8402090"
FT                   /translation="MIAGIAFAIATLGALLLLVLYARIRAVDEELKLKKHRSRDAGLAD
FT                   LLNYAAMVDDGVMVGKNGAFLAAWLYKGADNASSTDEQREIVSLRINQALSGLGNGWMV
FT                   HVDAARLPAPNYLDRGTSHFPDGVSAAIDEERRQLFEGLGTLYEGYYVLTLTWFPALLA
FT                   QRKFVELMFDDDAKAPDHKAHTHGLIEFFKRECVSIESRLSSAVELQRLRGHQVVNEDG
FT                   SAVTHDDFLRWLQFCVTGVNHPVQLPSNPMYLDALIGGQELWTGVVPKVGRKFIQVVAI
FT                   EGFPLESTPGMLTALGELACEYRWSSRFIFMDTHEAVRHLDKFRKKWRQKIRGFFDQVF
FT                   NTHLGPIDQDALSMVADAEAAIAEVNSGLVAQGYYTSVVVLMDEDRSRLEASARQVEKA
FT                   VNRLGFAARIETLNTMDAYLGSLPGHGVENVRRPLINTMNLADLLPTSTIWTGSNAAPC
FT                   PMYPPLAPALMHCVTHGATPFRLNLHVRDLGHTFLFGPTGSGKSTHLGILAAQLRRYAG
FT                   MSIFAFDKGMAMYPLAAAIRAQTQGRSGRHFTVAADDDQLAFCPLQFLETKGDRAWAME
FT                   WIDTLLALNDLHTTPAQRNEIGHAILSLHASGGRTLSEFSVTIQDEAIRDAIRQYTVDG
FT                   AMGHLLDAEEDGLSFSDFTVFEIDELMNLGEKYALPVLLYLFRRIERALHGQPAVIMLD
FT                   EAWLMLGHPAFRAKIREWLKVLRKANCLVLMATQSLSDAANSGILDVIVESTATKIFLP
FT                   NLYARDEDTAALYRRMGLNTRQIEILATAIPKRQYYYVSENGRRLYDLALGPLALAFVG
FT                   ASDKESLATIQHLESKLGDGWVHEWLAGRGLTLDTYGVAA"
FT                   /protein_id="YP_003165298.1"
     MIAGIAFAIA TLGALLLLVL YARIRAVDEE LKLKKHRSRD AGLADLLNYA AMVDDGVMVG        60
     KNGAFLAAWL YKGADNASST DEQREIVSLR INQALSGLGN GWMVHVDAAR LPAPNYLDRG       120
     TSHFPDGVSA AIDEERRQLF EGLGTLYEGY YVLTLTWFPA LLAQRKFVEL MFDDDAKAPD       180
     HKAHTHGLIE FFKRECVSIE SRLSSAVELQ RLRGHQVVNE DGSAVTHDDF LRWLQFCVTG       240
     VNHPVQLPSN PMYLDALIGG QELWTGVVPK VGRKFIQVVA IEGFPLESTP GMLTALGELA       300
     CEYRWSSRFI FMDTHEAVRH LDKFRKKWRQ KIRGFFDQVF NTHLGPIDQD ALSMVADAEA       360
     AIAEVNSGLV AQGYYTSVVV LMDEDRSRLE ASARQVEKAV NRLGFAARIE TLNTMDAYLG       420
     SLPGHGVENV RRPLINTMNL ADLLPTSTIW TGSNAAPCPM YPPLAPALMH CVTHGATPFR       480
     LNLHVRDLGH TFLFGPTGSG KSTHLGILAA QLRRYAGMSI FAFDKGMAMY PLAAAIRAQT       540
     QGRSGRHFTV AADDDQLAFC PLQFLETKGD RAWAMEWIDT LLALNDLHTT PAQRNEIGHA       600
     ILSLHASGGR TLSEFSVTIQ DEAIRDAIRQ YTVDGAMGHL LDAEEDGLSF SDFTVFEIDE       660
     LMNLGEKYAL PVLLYLFRRI ERALHGQPAV IMLDEAWLML GHPAFRAKIR EWLKVLRKAN       720
     CLVLMATQSL SDAANSGILD VIVESTATKI FLPNLYARDE DTAALYRRMG LNTRQIEILA       780
     TAIPKRQYYY VSENGRRLYD LALGPLALAF VGASDKESLA TIQHLESKLG DGWVHEWLAG       840
     RGLTLDTYGV AA                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page