(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE151

ACCPU_3.PE151        Location/Qualifiers
FT   CDS             complement(162357..162668)
FT                   /locus_tag="CAP2UW1_4730"
FT                   /gene_family="HOG000289425" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbD"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091656"
FT                   /db_xref="GeneID:8402091"
FT                   /translation="MALRKIPIRRAGNRDNLFMGGDRELVMFSGLLAFALVFSAQELRA
FT                   TVVGLLLWFGALYALRIMAKADPRMRHVYLRHRRYKPYYPARSTPFRDNTTSQGKQYQ"
FT                   /protein_id="YP_003165299.1"
     MALRKIPIRR AGNRDNLFMG GDRELVMFSG LLAFALVFSA QELRATVVGL LLWFGALYAL        60
     RIMAKADPRM RHVYLRHRRY KPYYPARSTP FRDNTTSQGK QYQ                         103
//

If you have problems or comments...

PBIL Back to PBIL home page