(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE152

ACCPU_3.PE152        Location/Qualifiers
FT   CDS             complement(162671..163093)
FT                   /locus_tag="CAP2UW1_4731"
FT                   /gene_family="HOG000289414" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbC"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091657"
FT                   /db_xref="GeneID:8402092"
FT                   /translation="MHSPALPYPLARSTLFYCGLAILLLVFLLVPQHALAAEGTGGSLP
FT                   YESWLTNLRNSVTGPVAFALAMIGIVVAGGVLIFGGDLNGFFRTLIFVVLVMALLVGAQ
FT                   NMMSSFFGRGAEIAALGAGGFDPVQLAGGIAPGRLA"
FT                   /protein_id="YP_003165300.1"
     MHSPALPYPL ARSTLFYCGL AILLLVFLLV PQHALAAEGT GGSLPYESWL TNLRNSVTGP        60
     VAFALAMIGI VVAGGVLIFG GDLNGFFRTL IFVVLVMALL VGAQNMMSSF FGRGAEIAAL       120
     GAGGFDPVQL AGGIAPGRLA                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page