(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE155

ACCPU_3.PE155        Location/Qualifiers
FT   CDS             complement(165190..166233)
FT                   /locus_tag="CAP2UW1_4734"
FT                   /gene_family="HOG000097665" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091660"
FT                   /db_xref="GeneID:8402095"
FT                   /translation="MLIPPDYAAWLAELKTTIRTARLKAGLAVNRELVLLYWRIGKEIL
FT                   ERQSAQGWGAKVIDQLARDLRAEFSDMRGFSRTNLLYMRAFASAWPEEAIVHQLGGQIP
FT                   WRHNCVIIDQAKDRPTREWYIRKTIENGWSRSVLELQIETAAHRRVGAAQTNFDRALPS
FT                   PQSDLARDILKDPYTFDFLGITDASNERTIEKALVLRLRDFLIELGVGFAFVGSQYRLE
FT                   VDGDEFFMDLLFYHTRLHCYVVIELKNTAFRPEYVGKLNFYLAAVDELVRNQTVDAPTI
FT                   GLVLCKSKKGTVVEYALRDIHAPMGVSTYRTALPDAMAGVLPSIEALTEELQALQGGEH
FT                   DDLEPDQ"
FT                   /protein_id="YP_003165303.1"
     MLIPPDYAAW LAELKTTIRT ARLKAGLAVN RELVLLYWRI GKEILERQSA QGWGAKVIDQ        60
     LARDLRAEFS DMRGFSRTNL LYMRAFASAW PEEAIVHQLG GQIPWRHNCV IIDQAKDRPT       120
     REWYIRKTIE NGWSRSVLEL QIETAAHRRV GAAQTNFDRA LPSPQSDLAR DILKDPYTFD       180
     FLGITDASNE RTIEKALVLR LRDFLIELGV GFAFVGSQYR LEVDGDEFFM DLLFYHTRLH       240
     CYVVIELKNT AFRPEYVGKL NFYLAAVDEL VRNQTVDAPT IGLVLCKSKK GTVVEYALRD       300
     IHAPMGVSTY RTALPDAMAG VLPSIEALTE ELQALQGGEH DDLEPDQ                     347
//

If you have problems or comments...

PBIL Back to PBIL home page