(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE156

ACCPU_3.PE156        Location/Qualifiers
FT   CDS             complement(166246..167226)
FT                   /locus_tag="CAP2UW1_4735"
FT                   /gene_family="HOG000130877" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091661"
FT                   /db_xref="GeneID:8402096"
FT                   /translation="MNVPELIFPGIDVAKDTLELALDDQSKTECIANSGKEIGALVNRL
FT                   KLLAERIGVILLEATGGYERPVAAALCAAGLPVMVVNPRQARDFAKSMGYLAKTDAIDA
FT                   RVLSHFGRTLHQSAQRERLLMKLPDANQEALEALLVRHNQLVAMRVAEANRLATSHPSQ
FT                   HKSIKLVLKMLDRQIALIDKNIDGMLKGHFAQKLALFKDFKGVGPCMQAALMGALPELG
FT                   QLTHAQIGKLVGVAPLNADSGRHKGKRITWGGRATVRTTLYMAALSAIRYNPVIKIFYE
FT                   RLLAKGKLKKVALVACMHKMLTIMNAIVKSGIPWNPEHPNAPKNA"
FT                   /protein_id="YP_003165304.1"
     MNVPELIFPG IDVAKDTLEL ALDDQSKTEC IANSGKEIGA LVNRLKLLAE RIGVILLEAT        60
     GGYERPVAAA LCAAGLPVMV VNPRQARDFA KSMGYLAKTD AIDARVLSHF GRTLHQSAQR       120
     ERLLMKLPDA NQEALEALLV RHNQLVAMRV AEANRLATSH PSQHKSIKLV LKMLDRQIAL       180
     IDKNIDGMLK GHFAQKLALF KDFKGVGPCM QAALMGALPE LGQLTHAQIG KLVGVAPLNA       240
     DSGRHKGKRI TWGGRATVRT TLYMAALSAI RYNPVIKIFY ERLLAKGKLK KVALVACMHK       300
     MLTIMNAIVK SGIPWNPEHP NAPKNA                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page