(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE16

ACCPU_3.PE16         Location/Qualifiers
FT   CDS             13573..14001
FT                   /locus_tag="CAP2UW1_4584"
FT                   /gene_family="HOG000262558" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091521"
FT                   /db_xref="GeneID:8401956"
FT                   /translation="MTVVVADTSVYVSALVFGGVPQAALIKAITTPFRVAISHALKAEL
FT                   VETLERKFAWPSSRVAHACAHLWGGAIWCEPVAVQASRDPDDDHVLGCAIAASANVLVT
FT                   GDKDLLSLHPFRGIAIVTPATFLAMPWTVHGDDRAPFV"
FT                   /protein_id="YP_003165164.1"
     MTVVVADTSV YVSALVFGGV PQAALIKAIT TPFRVAISHA LKAELVETLE RKFAWPSSRV        60
     AHACAHLWGG AIWCEPVAVQ ASRDPDDDHV LGCAIAASAN VLVTGDKDLL SLHPFRGIAI       120
     VTPATFLAMP WTVHGDDRAP FV                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page