(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE17

ACCPU_3.PE17         Location/Qualifiers
FT   CDS             14029..14151
FT                   /locus_tag="CAP2UW1_4585"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091522"
FT                   /db_xref="GeneID:8401957"
FT                   /translation="MQKLFTERHGSTKPCVAEKRAAMNTATFFAERRGADDQIF"
FT                   /protein_id="YP_003165165.1"
     MQKLFTERHG STKPCVAEKR AAMNTATFFA ERRGADDQIF                              40
//

If you have problems or comments...

PBIL Back to PBIL home page