(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE19

ACCPU_3.PE19         Location/Qualifiers
FT   CDS             complement(14660..17005)
FT                   /locus_tag="CAP2UW1_4587"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091524"
FT                   /db_xref="GeneID:8401959"
FT                   /translation="MADETQRNARNDRLPIKLIMPKQGTERRVLGGGTPPAPFRDVDLQ
FT                   YRNRLSNQIGAIQEALLPQLKMTRAAPVRVKIMSKAAAKSHRPEKLFSDKSCPIIGAGR
FT                   LGELFIKATPTGLEQLTQIIQNNTSDQITKELSCIESIEAVTPASRRHGLGAEDILCRS
FT                   PRRRNGFITRVRLFSFGADDDHPALVANFESVCRERGIKLDQRGYSERSFIYAAECQTV
FT                   ADVEALSRIIGVRSISHMPLVRTIRPRMMNQQALPALPTRDAADADVPVVVVVDGGISD
FT                   QIPALNSWVVGRVRDVSPPYDQNTDHGTFVAGLVCWGRELNPTVGGLDSGACAVFDLQV
FT                   IPNDDPSRGETSALLESELLSSLESALQEHANKYRVWNLSLGTDAICSLDEFSELAEEL
FT                   DNLQEKYQVSFVISAGNYATLPLLDFPRTPGQIEVGRITSPADSVLGITVGSVSHVDYK
FT                   TNGPRQHHPSAFSRHGAGPNYIIKPDLVHYGGSCSTDAAHVHGIRSVTDSGLAEDLGTS
FT                   FATPLVSRTLAQIYHQITPTPSPVLARALLTHHARDPRSGTRVPDGEENFLGFGLPAAV
FT                   PYCLECTPHTATLVFEDTLRPGYFLEWDDFPYPPSLKRNDKYFGEVWMTLAFVPTRGAR
FT                   WGSEYCETHIDAHLGVYRDRVSRTTGEIKRMFAGLVPPEHRNPGLLYEAYQVEKMRKWA
FT                   PVRTYHGRLNENGERGNRWRLMLKLLTRHGIEKDEAAFKPQPFSLIITIADPEKKASVY
FT                   DEVAQIVRNRFQAQNLTIRARARVQGKA"
FT                   /protein_id="YP_003165167.1"
     MADETQRNAR NDRLPIKLIM PKQGTERRVL GGGTPPAPFR DVDLQYRNRL SNQIGAIQEA        60
     LLPQLKMTRA APVRVKIMSK AAAKSHRPEK LFSDKSCPII GAGRLGELFI KATPTGLEQL       120
     TQIIQNNTSD QITKELSCIE SIEAVTPASR RHGLGAEDIL CRSPRRRNGF ITRVRLFSFG       180
     ADDDHPALVA NFESVCRERG IKLDQRGYSE RSFIYAAECQ TVADVEALSR IIGVRSISHM       240
     PLVRTIRPRM MNQQALPALP TRDAADADVP VVVVVDGGIS DQIPALNSWV VGRVRDVSPP       300
     YDQNTDHGTF VAGLVCWGRE LNPTVGGLDS GACAVFDLQV IPNDDPSRGE TSALLESELL       360
     SSLESALQEH ANKYRVWNLS LGTDAICSLD EFSELAEELD NLQEKYQVSF VISAGNYATL       420
     PLLDFPRTPG QIEVGRITSP ADSVLGITVG SVSHVDYKTN GPRQHHPSAF SRHGAGPNYI       480
     IKPDLVHYGG SCSTDAAHVH GIRSVTDSGL AEDLGTSFAT PLVSRTLAQI YHQITPTPSP       540
     VLARALLTHH ARDPRSGTRV PDGEENFLGF GLPAAVPYCL ECTPHTATLV FEDTLRPGYF       600
     LEWDDFPYPP SLKRNDKYFG EVWMTLAFVP TRGARWGSEY CETHIDAHLG VYRDRVSRTT       660
     GEIKRMFAGL VPPEHRNPGL LYEAYQVEKM RKWAPVRTYH GRLNENGERG NRWRLMLKLL       720
     TRHGIEKDEA AFKPQPFSLI ITIADPEKKA SVYDEVAQIV RNRFQAQNLT IRARARVQGK       780
     A                                                                       781
//

If you have problems or comments...

PBIL Back to PBIL home page