(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE20

ACCPU_3.PE20         Location/Qualifiers
FT   CDS             complement(16998..18158)
FT                   /locus_tag="CAP2UW1_4588"
FT                   /gene_family="HOG000058087" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091525"
FT                   /db_xref="GeneID:8401960"
FT                   /translation="MNTDIRFINELVRIVNGALRLDVDKVRNYTAFLAEKLETAGEKSS
FT                   ADRLRKLLEETDNQLRPADVRFSTTLPVDAESRFPLIEHIKLKTLQEPPVQLLQSQWDV
FT                   VNEFVSVAKSYALLDTTELSGALSFLMYGPPGTGKSRVARHIAKEIGLELYVARLDGLI
FT                   SSYLGSTSKNIRALFDFAAKTPCVLFLDEFDAIAKLRGDSQELGELKRVVNSFLQNLDT
FT                   LGRQSIVLAATNHETLLDTAVWRRFTYRLALQLPSSEQREHMWADFIEPIHFSPRDLTV
FT                   LADLSEGFSGSDIREVCARLKRRHFSTGKPIYLKDAFPVLQNLAIGAEDGARFIARLAN
FT                   KEAPDIVEALRERDQRLYSFAMLGELLGLSKATVHRVSKLEGEERG"
FT                   /protein_id="YP_003165168.1"
     MNTDIRFINE LVRIVNGALR LDVDKVRNYT AFLAEKLETA GEKSSADRLR KLLEETDNQL        60
     RPADVRFSTT LPVDAESRFP LIEHIKLKTL QEPPVQLLQS QWDVVNEFVS VAKSYALLDT       120
     TELSGALSFL MYGPPGTGKS RVARHIAKEI GLELYVARLD GLISSYLGST SKNIRALFDF       180
     AAKTPCVLFL DEFDAIAKLR GDSQELGELK RVVNSFLQNL DTLGRQSIVL AATNHETLLD       240
     TAVWRRFTYR LALQLPSSEQ REHMWADFIE PIHFSPRDLT VLADLSEGFS GSDIREVCAR       300
     LKRRHFSTGK PIYLKDAFPV LQNLAIGAED GARFIARLAN KEAPDIVEAL RERDQRLYSF       360
     AMLGELLGLS KATVHRVSKL EGEERG                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page