(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE21

ACCPU_3.PE21         Location/Qualifiers
FT   CDS             18330..18599
FT                   /locus_tag="CAP2UW1_4589"
FT                   /gene_family="HOG000260299" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091526"
FT                   /db_xref="GeneID:8401961"
FT                   /translation="MNVNLTPQIEEMVRRKVASGLYTSASEVVREALRVMDEQGRVRAA
FT                   KLEQLRQDLRDGLDSGEPTPWDPEEIKREGRKRRTARVPAGQDT"
FT                   /protein_id="YP_003165169.1"
     MNVNLTPQIE EMVRRKVASG LYTSASEVVR EALRVMDEQG RVRAAKLEQL RQDLRDGLDS        60
     GEPTPWDPEE IKREGRKRRT ARVPAGQDT                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page