(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE23

ACCPU_3.PE23         Location/Qualifiers
FT   CDS             complement(18964..22257)
FT                   /locus_tag="CAP2UW1_4591"
FT                   /gene_family="HOG000055008" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091528"
FT                   /db_xref="GeneID:8401963"
FT                   /translation="MPLLTDFDWQSKYDHDHGSLIEQFYLRALACAQRYDRTTGYFTAT
FT                   ALAIAARGLEGLVLNNGRMRLVVGCTLDEPEVAAIEHGQSLKDTVEGRLLKMPLAGSSP
FT                   REQQALELLAWMVARGYLEIKVAVPCDDDRNPVATQAIFHEKAGILEDKTGARLAFAGS
FT                   VNETAYGWLHNWESFHVFCDWDGGAGHVDAEEKSFALLWADRARRARVLDVPAAVREEL
FT                   LRFLPREADEPERVKRARNGDAVRDSTADDETDQRRSTPQATSVDERRKAVWQLIWSAP
FT                   RQPGGERIAEATSAVTPWPHQILTFQRMLDHWPPRLLIADEVGLGKTIEAGLVLRYAWL
FT                   SGRAQRILIMAPKAVMTQWQAELREKFNLNWPIYDGKRLSWYPSPLLRGKSEKEVARDE
FT                   WHREPFVIVSSHLMRRRDRQNELLEVADPWDLIVLDESHHARRKSPGAAQEGPPNLLLK
FT                   LMQRLKERTDGLLLLTATPMQVHPVEVWDLLSLLAMPPAWSRQGFLEFFRKSGSGNPSH
FT                   EDFEFLAALFRAAEAAFGEVSIESAVRRAPERSLLKAKRILRSLRDAAATPRRQLSAEE
FT                   RRSAVAIMRAHTPVAGLVSRHTRGLLREYHRRGLLSTPIATREVVDEFLDMAPAEAAVY
FT                   DALEAYISTTYNNAQEERRTAVGFVMTTYRKRLSSSFHALKMTLEERLAVVRGQAGLPF
FT                   DELRSSEDAEDDIDESGDAADEEAVDRQKQAALQLEEQGDIETLLEQARRLPVDTKAVR
FT                   LAEVLQALQRGSYHAMDDSLLPAFPQAIVFTQYTDTLDYLRDFLKTQGFSVLCYSGRGG
FT                   EWLQPDGSWKRLTREETKRRFKRQDAQVLVCTDAAAEGLNFQFCGALVNFDSPWNPMRI
FT                   EQRIGRVDRLGQQFPRIAIVNLMYEDTVETDVYRALRSRISLFTSVVGPLQPILSAMPA
FT                   RIAEVALMRPENQQQARANLVSELQQAASQTPADSFNIDEAIEAALEEPERAPAPYGLE
FT                   ELGHLLDHPKLLPPGVEAQRVGTKEVFWTQPGAPRISVTTDPDFFEEHPESVEFWTPGS
FT                   PAFPEDSGSGVQSADGETLATLIRATRDLSSRLSNRTTECALQSVNAVL"
FT                   /protein_id="YP_003165171.1"
     MPLLTDFDWQ SKYDHDHGSL IEQFYLRALA CAQRYDRTTG YFTATALAIA ARGLEGLVLN        60
     NGRMRLVVGC TLDEPEVAAI EHGQSLKDTV EGRLLKMPLA GSSPREQQAL ELLAWMVARG       120
     YLEIKVAVPC DDDRNPVATQ AIFHEKAGIL EDKTGARLAF AGSVNETAYG WLHNWESFHV       180
     FCDWDGGAGH VDAEEKSFAL LWADRARRAR VLDVPAAVRE ELLRFLPREA DEPERVKRAR       240
     NGDAVRDSTA DDETDQRRST PQATSVDERR KAVWQLIWSA PRQPGGERIA EATSAVTPWP       300
     HQILTFQRML DHWPPRLLIA DEVGLGKTIE AGLVLRYAWL SGRAQRILIM APKAVMTQWQ       360
     AELREKFNLN WPIYDGKRLS WYPSPLLRGK SEKEVARDEW HREPFVIVSS HLMRRRDRQN       420
     ELLEVADPWD LIVLDESHHA RRKSPGAAQE GPPNLLLKLM QRLKERTDGL LLLTATPMQV       480
     HPVEVWDLLS LLAMPPAWSR QGFLEFFRKS GSGNPSHEDF EFLAALFRAA EAAFGEVSIE       540
     SAVRRAPERS LLKAKRILRS LRDAAATPRR QLSAEERRSA VAIMRAHTPV AGLVSRHTRG       600
     LLREYHRRGL LSTPIATREV VDEFLDMAPA EAAVYDALEA YISTTYNNAQ EERRTAVGFV       660
     MTTYRKRLSS SFHALKMTLE ERLAVVRGQA GLPFDELRSS EDAEDDIDES GDAADEEAVD       720
     RQKQAALQLE EQGDIETLLE QARRLPVDTK AVRLAEVLQA LQRGSYHAMD DSLLPAFPQA       780
     IVFTQYTDTL DYLRDFLKTQ GFSVLCYSGR GGEWLQPDGS WKRLTREETK RRFKRQDAQV       840
     LVCTDAAAEG LNFQFCGALV NFDSPWNPMR IEQRIGRVDR LGQQFPRIAI VNLMYEDTVE       900
     TDVYRALRSR ISLFTSVVGP LQPILSAMPA RIAEVALMRP ENQQQARANL VSELQQAASQ       960
     TPADSFNIDE AIEAALEEPE RAPAPYGLEE LGHLLDHPKL LPPGVEAQRV GTKEVFWTQP      1020
     GAPRISVTTD PDFFEEHPES VEFWTPGSPA FPEDSGSGVQ SADGETLATL IRATRDLSSR      1080
     LSNRTTECAL QSVNAVL                                                     1097
//

If you have problems or comments...

PBIL Back to PBIL home page