(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE24

ACCPU_3.PE24         Location/Qualifiers
FT   CDS             complement(22270..25227)
FT                   /locus_tag="CAP2UW1_4592"
FT                   /gene_family="HOG000055007" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091529"
FT                   /db_xref="GeneID:8401964"
FT                   /translation="MTRRLIETWLPIAALGIESLRERTPMTPFPAPNRLHVWWARRPLV
FT                   ASRAAVLASLLPVDADHGKFLHMLGIHGDAAASRRRIDAARRKGERFEGQAYSYSRAFT
FT                   YAPSDADRSWARTGYGRLGLDQIAVLDPTAGGGAIPFESARLGFDTFGNDLNPVAALIE
FT                   RATIELPLKHGLAVLRQFERIASEYIERREKRLLPFFPPEPAENAIPTNFIWARTIRCP
FT                   HCEGLVPLSPNWRLAPDGTGVRLLPDKGKGPGDKTRHLHFEIVSTAKEHSTSTVSGGDA
FT                   TCPFDDCGRLIAGDHIKAEAQAGRMGQQLYTVVFKKKLITGHTKAGKPKEKWVRGYRAP
FT                   RPEDDVSEAVADALTEKLPDWEALDMVPTERVPEDINDDRPIQYGMPLWRDLFSPRQLL
FT                   GHCTAVEVFRELIVEEKSFGRWNECTAAAFCYLSFSLDKLRDYNSRMSRWHVNREVMVN
FT                   TFDRHDFAFKWSYAEMPPLIEGLGYDWAIEQTAKCIGELVALTRPDAGATASPQSKFNF
FT                   DGAPAFTPPPVTLTCKSGDSLDHIADASIDAVVMDPPYYDNVMYAELSDFFYVWLKRTA
FT                   GYIYPELFRRALTDKENEAVANPAKFKGEKGAKALAGRDYQQRMAAIFTEMRRVLKPDG
FT                   IMTLMFTHKATGAWDALTKGLMEAGFAITASWPINTEAEGSLHIKDKSAANSTVFLVCR
FT                   PLAQPGADTRYWEDVEPKVRAAVRERIGVFQTAGIRGVDLYLSCFGPALEVFSQAWPLV
FT                   RGTPRQDIEQSRRKRRQAEMFDEAYDPFAVTPEDALVAARTEVKQWRLSQLAHVRRNVE
FT                   LDNLTSWFVLAWDAFEAPIFPFDEANKLAKVCGVDLDRDVVGRLAEKKGADLVLWDSVT
FT                   RAAKGSLGLPDGRDSMMDALHQLARTARTASLESANELLAKHGLAVEPAFLTALEAVLE
FT                   VLPVGSIWSGFDLPDAAKGAGADFDALENLRRLALAEKVAEPEQLKIWQQEELTV"
FT                   /protein_id="YP_003165172.1"
     MTRRLIETWL PIAALGIESL RERTPMTPFP APNRLHVWWA RRPLVASRAA VLASLLPVDA        60
     DHGKFLHMLG IHGDAAASRR RIDAARRKGE RFEGQAYSYS RAFTYAPSDA DRSWARTGYG       120
     RLGLDQIAVL DPTAGGGAIP FESARLGFDT FGNDLNPVAA LIERATIELP LKHGLAVLRQ       180
     FERIASEYIE RREKRLLPFF PPEPAENAIP TNFIWARTIR CPHCEGLVPL SPNWRLAPDG       240
     TGVRLLPDKG KGPGDKTRHL HFEIVSTAKE HSTSTVSGGD ATCPFDDCGR LIAGDHIKAE       300
     AQAGRMGQQL YTVVFKKKLI TGHTKAGKPK EKWVRGYRAP RPEDDVSEAV ADALTEKLPD       360
     WEALDMVPTE RVPEDINDDR PIQYGMPLWR DLFSPRQLLG HCTAVEVFRE LIVEEKSFGR       420
     WNECTAAAFC YLSFSLDKLR DYNSRMSRWH VNREVMVNTF DRHDFAFKWS YAEMPPLIEG       480
     LGYDWAIEQT AKCIGELVAL TRPDAGATAS PQSKFNFDGA PAFTPPPVTL TCKSGDSLDH       540
     IADASIDAVV MDPPYYDNVM YAELSDFFYV WLKRTAGYIY PELFRRALTD KENEAVANPA       600
     KFKGEKGAKA LAGRDYQQRM AAIFTEMRRV LKPDGIMTLM FTHKATGAWD ALTKGLMEAG       660
     FAITASWPIN TEAEGSLHIK DKSAANSTVF LVCRPLAQPG ADTRYWEDVE PKVRAAVRER       720
     IGVFQTAGIR GVDLYLSCFG PALEVFSQAW PLVRGTPRQD IEQSRRKRRQ AEMFDEAYDP       780
     FAVTPEDALV AARTEVKQWR LSQLAHVRRN VELDNLTSWF VLAWDAFEAP IFPFDEANKL       840
     AKVCGVDLDR DVVGRLAEKK GADLVLWDSV TRAAKGSLGL PDGRDSMMDA LHQLARTART       900
     ASLESANELL AKHGLAVEPA FLTALEAVLE VLPVGSIWSG FDLPDAAKGA GADFDALENL       960
     RRLALAEKVA EPEQLKIWQQ EELTV                                             985
//

If you have problems or comments...

PBIL Back to PBIL home page