(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE25

ACCPU_3.PE25         Location/Qualifiers
FT   CDS             complement(25315..27051)
FT                   /locus_tag="CAP2UW1_4593"
FT                   /gene_family="HOG000158239" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091530"
FT                   /db_xref="GeneID:8401965"
FT                   /translation="MRELTEIRSLLDRLDEVEADALETQDLDFKEWPAEPRQAIKLAVD
FT                   IAICMANGGGGSVVLGVRDRVVGRAKAILGVPPETEIHQLKRDIYERTAPKLTPDIHEL
FT                   HVLEGSGRLLVMQVHGGLSPYTNTAGAGTVRKGNACVPLTGDLREKLMVERGDADFTAA
FT                   IVPEPAQSLISAAAMERLRDQARQEQAPTDLLRKSDLDLLGAIGVLRDGQLTRAGLLIA
FT                   GQAEAIGRHLPNFGWTHERMKSATAYDNRADGRDENALALPLALAAIEARINADNPIST
FT                   IEHGLYHFEYRAYPTIALREALLNALTHLDLRLASPVLVKQYPRRLEITNPGGLVGGIT
FT                   SANILHHPPLARNLQLVQALARLRLVNRSNLGIGRMFEAMLVEGKEPPLIIDEESAVRV
FT                   VFKRQETARPFREFIAEEGKTGRTLDVDHLLVLRYLLSHPEIDTSTAAELCQRRDAEMR
FT                   DILDEMVQIFDYLERGGAGRGSWWRMKPALHRRLEGLGHAERDQRIDWDVAKTRVLNML
FT                   KQRARRGEPGLTNAGIREVTAYDRQQVNRLIHELEAEGVRMQGHGRGSCYTYIGRTHNE
FT                   QG"
FT                   /protein_id="YP_003165173.1"
     MRELTEIRSL LDRLDEVEAD ALETQDLDFK EWPAEPRQAI KLAVDIAICM ANGGGGSVVL        60
     GVRDRVVGRA KAILGVPPET EIHQLKRDIY ERTAPKLTPD IHELHVLEGS GRLLVMQVHG       120
     GLSPYTNTAG AGTVRKGNAC VPLTGDLREK LMVERGDADF TAAIVPEPAQ SLISAAAMER       180
     LRDQARQEQA PTDLLRKSDL DLLGAIGVLR DGQLTRAGLL IAGQAEAIGR HLPNFGWTHE       240
     RMKSATAYDN RADGRDENAL ALPLALAAIE ARINADNPIS TIEHGLYHFE YRAYPTIALR       300
     EALLNALTHL DLRLASPVLV KQYPRRLEIT NPGGLVGGIT SANILHHPPL ARNLQLVQAL       360
     ARLRLVNRSN LGIGRMFEAM LVEGKEPPLI IDEESAVRVV FKRQETARPF REFIAEEGKT       420
     GRTLDVDHLL VLRYLLSHPE IDTSTAAELC QRRDAEMRDI LDEMVQIFDY LERGGAGRGS       480
     WWRMKPALHR RLEGLGHAER DQRIDWDVAK TRVLNMLKQR ARRGEPGLTN AGIREVTAYD       540
     RQQVNRLIHE LEAEGVRMQG HGRGSCYTYI GRTHNEQG                               578
//

If you have problems or comments...

PBIL Back to PBIL home page