(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE26

ACCPU_3.PE26         Location/Qualifiers
FT   CDS             complement(27055..27534)
FT                   /locus_tag="CAP2UW1_4594"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091531"
FT                   /db_xref="GeneID:8401966"
FT                   /translation="MSKVTHLSAAKHASALPQYEMRARRLAGSDIEVEIWQLPAGATPH
FT                   IRQPTYIAGLRGRNLSLIEHRLLRRLKQLRIDLSNLPAFDALRLAVDEEMAISLGLLFR
FT                   ALAPMRNREHIAAVAEGIEAMSKEEAGYWLGMAMHRKHPRRVLMALRFLLIEPKP"
FT                   /protein_id="YP_003165174.1"
     MSKVTHLSAA KHASALPQYE MRARRLAGSD IEVEIWQLPA GATPHIRQPT YIAGLRGRNL        60
     SLIEHRLLRR LKQLRIDLSN LPAFDALRLA VDEEMAISLG LLFRALAPMR NREHIAAVAE       120
     GIEAMSKEEA GYWLGMAMHR KHPRRVLMAL RFLLIEPKP                              159
//

If you have problems or comments...

PBIL Back to PBIL home page