(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE27

ACCPU_3.PE27         Location/Qualifiers
FT   CDS             complement(27557..30589)
FT                   /locus_tag="CAP2UW1_4595"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091532"
FT                   /db_xref="GeneID:8401967"
FT                   /translation="MTDNLFSICEPRPDVLQGALRESDFAADLSQVLRGDAPDEYKRPE
FT                   LFFANTYPTKGIKNVLKLVALRVSGHSDQIGAIFRLDTQFGGGKTHALIALAHAMRSLS
FT                   EVANADEFLDASLRPSAPVRIAAFDGENADPANGHRIGDTLRAYTPWGELAYALRGEAG
FT                   YRLVEASDREGIAPGADTLRELIGSEPAVILIDEIAPYLRKVAGRNAQRAGEQLLAFMT
FT                   SLMKAVESSPYAALVFTLAVGRDGKASDAYSRETQDIAAFFAEAESVAARKATVIDPTE
FT                   DDETVKVICRRLFTRIDRDKARLVISAYKSLWDANRELLPPAPAEDRRLDEFAAGYPLH
FT                   PELVNVLTQKTGTLGNFQRVRGMLRLLARTVARVWQTHPADAYAIHTHHIDLGFEPIRL
FT                   ELVTRLKQDIYVPAIKTEIAAVETTPALAEQLDAGPFRGLPKYGSYVARCAFMHTLAFN
FT                   ETLRGLNAEELRYAILSPGTDVAFIDDARKRFATDSAYLDDKPGAPLRFLAEANLTQII
FT                   RREETNTDRDEARTRLNSFIRDLFAGPNLNLIPFASGPHDVPDDDGSGRPYLVMLGYEA
FT                   TQVFSDAVTVDNLVEKVFLHKGGGSDWRHNRNNIVFLLADAAGVPNMKAKMLRNIALES
FT                   LRQPGKLKDLADYQVAKLQELHERSKQELALAVQQCFRHIFYPSRNRLDGANCDLAHTV
FT                   VDIQTASDRPGDGQRQVVTQLQNAGKLRLPTDKPDSPVYVRDRTPLKKGQITTAALRTE
FT                   FRQDPSLPMLVGDEVFIKGIRLGIEQDDYVYQSGDLLRGKGDPHAEIKVDEQSFIYTTS
FT                   YAQEHGIWPRQEPKSETSKTDSGARPTNDQADQRPVDYAATSDRTMPKAKSPPLLEAED
FT                   VLKAALTRLLEQARLNGIRSLATLTIRPFDKSDALKLMPLVKSIPNASKRVEMTASFET
FT                   ASGSSAELSFKGDIEDAIALKDYLEPQFRAASDSDAAVSFSLRFEPPLAVQGPSAEGLI
FT                   QRLTRLVSPSAHVLATAAEQD"
FT                   /protein_id="YP_003165175.1"
     MTDNLFSICE PRPDVLQGAL RESDFAADLS QVLRGDAPDE YKRPELFFAN TYPTKGIKNV        60
     LKLVALRVSG HSDQIGAIFR LDTQFGGGKT HALIALAHAM RSLSEVANAD EFLDASLRPS       120
     APVRIAAFDG ENADPANGHR IGDTLRAYTP WGELAYALRG EAGYRLVEAS DREGIAPGAD       180
     TLRELIGSEP AVILIDEIAP YLRKVAGRNA QRAGEQLLAF MTSLMKAVES SPYAALVFTL       240
     AVGRDGKASD AYSRETQDIA AFFAEAESVA ARKATVIDPT EDDETVKVIC RRLFTRIDRD       300
     KARLVISAYK SLWDANRELL PPAPAEDRRL DEFAAGYPLH PELVNVLTQK TGTLGNFQRV       360
     RGMLRLLART VARVWQTHPA DAYAIHTHHI DLGFEPIRLE LVTRLKQDIY VPAIKTEIAA       420
     VETTPALAEQ LDAGPFRGLP KYGSYVARCA FMHTLAFNET LRGLNAEELR YAILSPGTDV       480
     AFIDDARKRF ATDSAYLDDK PGAPLRFLAE ANLTQIIRRE ETNTDRDEAR TRLNSFIRDL       540
     FAGPNLNLIP FASGPHDVPD DDGSGRPYLV MLGYEATQVF SDAVTVDNLV EKVFLHKGGG       600
     SDWRHNRNNI VFLLADAAGV PNMKAKMLRN IALESLRQPG KLKDLADYQV AKLQELHERS       660
     KQELALAVQQ CFRHIFYPSR NRLDGANCDL AHTVVDIQTA SDRPGDGQRQ VVTQLQNAGK       720
     LRLPTDKPDS PVYVRDRTPL KKGQITTAAL RTEFRQDPSL PMLVGDEVFI KGIRLGIEQD       780
     DYVYQSGDLL RGKGDPHAEI KVDEQSFIYT TSYAQEHGIW PRQEPKSETS KTDSGARPTN       840
     DQADQRPVDY AATSDRTMPK AKSPPLLEAE DVLKAALTRL LEQARLNGIR SLATLTIRPF       900
     DKSDALKLMP LVKSIPNASK RVEMTASFET ASGSSAELSF KGDIEDAIAL KDYLEPQFRA       960
     ASDSDAAVSF SLRFEPPLAV QGPSAEGLIQ RLTRLVSPSA HVLATAAEQD                 1010
//

If you have problems or comments...

PBIL Back to PBIL home page