(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE28

ACCPU_3.PE28         Location/Qualifiers
FT   CDS             31062..32249
FT                   /locus_tag="CAP2UW1_4596"
FT                   /gene_family="HOG000005198" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091533"
FT                   /db_xref="GeneID:8401968"
FT                   /translation="MATLTWLDLTSRDRDKMRGVLDLFSEQGTVDEMGLGSLRDALSDA
FT                   LFPGTSSIQTRLRYALFVPWLYQRLEARPVDDVRTAAHEAETGLIEPLATSDDTFGVIG
FT                   ISARKTLSRLPSSVYWASLNRWGIFVPGQSQSWYHTHFAGLARRKSEVLRADDPGVVWT
FT                   REPTWHPRLPTAPADFPGCASFRLTKEEATFLQGRFEERCTGTLLAWLARAGSSTPAAQ
FT                   FWDDPGTCSAPSAVRRIVELARRFSLHVEGAPLLYNLLLAERRNGGGDDARVDAYRSEL
FT                   ARWAAEESAEAAYESPPLWAFLAERGASLSDPQRRFVEAWSDRISSSGASAVPDDPFLR
FT                   NLIEQRELKLKGRRARLANANRLLDWSGSVGVGRMGFRWFRVRQLLTDLHGGLKS"
FT                   /protein_id="YP_003165176.1"
     MATLTWLDLT SRDRDKMRGV LDLFSEQGTV DEMGLGSLRD ALSDALFPGT SSIQTRLRYA        60
     LFVPWLYQRL EARPVDDVRT AAHEAETGLI EPLATSDDTF GVIGISARKT LSRLPSSVYW       120
     ASLNRWGIFV PGQSQSWYHT HFAGLARRKS EVLRADDPGV VWTREPTWHP RLPTAPADFP       180
     GCASFRLTKE EATFLQGRFE ERCTGTLLAW LARAGSSTPA AQFWDDPGTC SAPSAVRRIV       240
     ELARRFSLHV EGAPLLYNLL LAERRNGGGD DARVDAYRSE LARWAAEESA EAAYESPPLW       300
     AFLAERGASL SDPQRRFVEA WSDRISSSGA SAVPDDPFLR NLIEQRELKL KGRRARLANA       360
     NRLLDWSGSV GVGRMGFRWF RVRQLLTDLH GGLKS                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page