(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE29

ACCPU_3.PE29         Location/Qualifiers
FT   CDS             32249..34039
FT                   /locus_tag="CAP2UW1_4597"
FT                   /gene_family="HOG000005199" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091534"
FT                   /db_xref="GeneID:8401969"
FT                   /translation="MLAPDARTVAVDLLRPPPEHTLDRVVLTTYSLDLETLLALPFAVL
FT                   THSDGGLEEMLADPLTLLTALRQSGEKVQVFVDEGAIAIPAGARPLYAMLEASVHPVRA
FT                   PHGGAFHPKVWVARFLGPAGAPVLRVAVLSRNLTFDRCWDIALATDGSPRGKQMSAASR
FT                   GLGELLRSLPRVSTQGVSEQLTADLLALADEAERTNFASPAGFNGAVHFHPLGLGPHRR
FT                   KPWQPRDDGGRLLAIAPFANKTALDVLTAITAADRTLVSRQETLDDLPNGALDAWQSVL
FT                   VLADAAAEEPEDGTGPRPSGLHAKAIAIEHGWDVTWFVGSANLTSAAFTGTNVEMMVSL
FT                   TGKKSRREAGGIDRFMEDGFMAICKPYVPGKPLLDELAKDAHASLEVTRKALAAAPLRV
FT                   VCAAGSQDSWTWTVVGDFVPPPGIEVETWPITLGEDQARQLVSPSIWIVPLPRLTAFVA
FT                   FKISCTVAAVDDVRITLKLPTEGMPDGRVAHVLRSLIDSPERFLRFLRALLGGLEGLTE
FT                   LPAGNGSGTGGSWWAEGLGGETLLEDLVRAASRDPSRLTPIRNLIADLRATEEGRLIVP
FT                   DALYEIWTVVDQALITQETA"
FT                   /protein_id="YP_003165177.1"
     MLAPDARTVA VDLLRPPPEH TLDRVVLTTY SLDLETLLAL PFAVLTHSDG GLEEMLADPL        60
     TLLTALRQSG EKVQVFVDEG AIAIPAGARP LYAMLEASVH PVRAPHGGAF HPKVWVARFL       120
     GPAGAPVLRV AVLSRNLTFD RCWDIALATD GSPRGKQMSA ASRGLGELLR SLPRVSTQGV       180
     SEQLTADLLA LADEAERTNF ASPAGFNGAV HFHPLGLGPH RRKPWQPRDD GGRLLAIAPF       240
     ANKTALDVLT AITAADRTLV SRQETLDDLP NGALDAWQSV LVLADAAAEE PEDGTGPRPS       300
     GLHAKAIAIE HGWDVTWFVG SANLTSAAFT GTNVEMMVSL TGKKSRREAG GIDRFMEDGF       360
     MAICKPYVPG KPLLDELAKD AHASLEVTRK ALAAAPLRVV CAAGSQDSWT WTVVGDFVPP       420
     PGIEVETWPI TLGEDQARQL VSPSIWIVPL PRLTAFVAFK ISCTVAAVDD VRITLKLPTE       480
     GMPDGRVAHV LRSLIDSPER FLRFLRALLG GLEGLTELPA GNGSGTGGSW WAEGLGGETL       540
     LEDLVRAASR DPSRLTPIRN LIADLRATEE GRLIVPDALY EIWTVVDQAL ITQETA           596
//

If you have problems or comments...

PBIL Back to PBIL home page