(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE3

ACCPU_3.PE3          Location/Qualifiers
FT   CDS             1485..2105
FT                   /locus_tag="CAP2UW1_4570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091508"
FT                   /db_xref="GeneID:8401943"
FT                   /translation="MPTPTSLNCHAPWKTCSNTHRDGTTHWQPRLRARSTSIVTRRTAS
FT                   RRCWRRWGVCNALYTPRAGQAVESSVLPVSPLARPSASHPLPRSLHWKQQEQGLDVWVR
FT                   FRPITAGQVFCPNDSNAAVAVVQPGVRRAQVTYELGAVGVGRPRRKFMSGCVASAARPP
FT                   SCVSSCGAKGARPSPLQTPPAAQQHRSTPAHQQGEHRNAAASN"
FT                   /protein_id="YP_003165151.1"
     MPTPTSLNCH APWKTCSNTH RDGTTHWQPR LRARSTSIVT RRTASRRCWR RWGVCNALYT        60
     PRAGQAVESS VLPVSPLARP SASHPLPRSL HWKQQEQGLD VWVRFRPITA GQVFCPNDSN       120
     AAVAVVQPGV RRAQVTYELG AVGVGRPRRK FMSGCVASAA RPPSCVSSCG AKGARPSPLQ       180
     TPPAAQQHRS TPAHQQGEHR NAAASN                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page