(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE30

ACCPU_3.PE30         Location/Qualifiers
FT   CDS             34036..37182
FT                   /locus_tag="CAP2UW1_4598"
FT                   /gene_family="HOG000005196" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091535"
FT                   /db_xref="GeneID:8401970"
FT                   /translation="MNRSDIEVVLASLKPFQRRTVDHAFDRLFLAKDSTSRFLVADEVG
FT                   LGKTLVARGLIARTIEHLWDTAKRIDIVYICSNGSIARANLPKLHVGATSDRSFALATR
FT                   LTMLATELAPRAGKPGLAASKVNFVSFTPGTSFDMGKATGQSEERVVLFRLLEPVVKAR
FT                   TGLMNLLQAGISNRDNWRWRLKNSDIALDPSIATNFRTALNADTALLTSINDVIEQWYH
FT                   YHRDRWPLEARQPRNYVISQLRQMLAKVCVLALEPDLVILDEFQRFKNLLETREDVRDE
FT                   AAILAQTLFGAQTPEGQPVRTLLLSATPYKLYTADAEIQDEDHYEDFLATSRFLMGNDE
FT                   ERVTSLQRCLSEFGLALKHAASGNTVAVVPAKKAVEKVLRSIMARTERISASEDRDAMV
FT                   EEPCVKITVKGADVKQYMAADALFKAVGDRDPMVFWKSAPYLMHFMRGYTVHTRIQETL
FT                   EQSPERLAKVLREHAAAFLEADKVTAWQAIDPANGKLREMVEDFLDGGLWRLLWMPPTF
FT                   PYWPLAGPFAGQEGKTKALVFSSWNVVPDVVSAILSYEAERRMVGSHLASYSDPAKQQV
FT                   PLLRLTASANGARSRHRLLLLLLPCLSLADQAHPLTAPAGINRRDWVRSRVESLLAIQP
FT                   NATTGDVDERWEWAAPMLLDPGLRSFIEELRAENSPDRPNPEQFPSYLDDLLQLDLTTL
FT                   GRRPEGLVDLLSDLALASPAVVVARTLAGAGVDDDVRRRLSLRLGESFWRMFNRPTVIS
FT                   LLLQLAQEAPDLTHNEGVYWRLVLRYCRDGNLQAVVDEAWHLEREQHTWAVDQTAETTA
FT                   EKVIAQLIKVVEPTPSRVHTSFWSVDADTGNILSTEIRVRTDFALRFGDVRTEEGKVTQ
FT                   DTVRAEFNSPFRPFVLASTSVGQEGLDFHPWCHRLVHWNLPGNPVDLEQREGRVHRYKG
FT                   HAVRKNVALSHATETLAVWKPGEDLWQIAFQFANDKARATGESDLVPNWIAPGPVRVQR
FT                   HVPMLPYTQEVEAFKRLKRQLAAYRVVFGQPRQDELLTLLDQAQLDVKQLREWAVDLSP
FT                   "
FT                   /protein_id="YP_003165178.1"
     MNRSDIEVVL ASLKPFQRRT VDHAFDRLFL AKDSTSRFLV ADEVGLGKTL VARGLIARTI        60
     EHLWDTAKRI DIVYICSNGS IARANLPKLH VGATSDRSFA LATRLTMLAT ELAPRAGKPG       120
     LAASKVNFVS FTPGTSFDMG KATGQSEERV VLFRLLEPVV KARTGLMNLL QAGISNRDNW       180
     RWRLKNSDIA LDPSIATNFR TALNADTALL TSINDVIEQW YHYHRDRWPL EARQPRNYVI       240
     SQLRQMLAKV CVLALEPDLV ILDEFQRFKN LLETREDVRD EAAILAQTLF GAQTPEGQPV       300
     RTLLLSATPY KLYTADAEIQ DEDHYEDFLA TSRFLMGNDE ERVTSLQRCL SEFGLALKHA       360
     ASGNTVAVVP AKKAVEKVLR SIMARTERIS ASEDRDAMVE EPCVKITVKG ADVKQYMAAD       420
     ALFKAVGDRD PMVFWKSAPY LMHFMRGYTV HTRIQETLEQ SPERLAKVLR EHAAAFLEAD       480
     KVTAWQAIDP ANGKLREMVE DFLDGGLWRL LWMPPTFPYW PLAGPFAGQE GKTKALVFSS       540
     WNVVPDVVSA ILSYEAERRM VGSHLASYSD PAKQQVPLLR LTASANGARS RHRLLLLLLP       600
     CLSLADQAHP LTAPAGINRR DWVRSRVESL LAIQPNATTG DVDERWEWAA PMLLDPGLRS       660
     FIEELRAENS PDRPNPEQFP SYLDDLLQLD LTTLGRRPEG LVDLLSDLAL ASPAVVVART       720
     LAGAGVDDDV RRRLSLRLGE SFWRMFNRPT VISLLLQLAQ EAPDLTHNEG VYWRLVLRYC       780
     RDGNLQAVVD EAWHLEREQH TWAVDQTAET TAEKVIAQLI KVVEPTPSRV HTSFWSVDAD       840
     TGNILSTEIR VRTDFALRFG DVRTEEGKVT QDTVRAEFNS PFRPFVLAST SVGQEGLDFH       900
     PWCHRLVHWN LPGNPVDLEQ REGRVHRYKG HAVRKNVALS HATETLAVWK PGEDLWQIAF       960
     QFANDKARAT GESDLVPNWI APGPVRVQRH VPMLPYTQEV EAFKRLKRQL AAYRVVFGQP      1020
     RQDELLTLLD QAQLDVKQLR EWAVDLSP                                         1048
//

If you have problems or comments...

PBIL Back to PBIL home page