(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE31

ACCPU_3.PE31         Location/Qualifiers
FT   CDS             37898..38206
FT                   /locus_tag="CAP2UW1_4599"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091536"
FT                   /db_xref="GeneID:8401971"
FT                   /translation="MMSNDVLDKVGKRLGDLSDLPEALRKQINTGKMGDIEEKILKTMR
FT                   QRYDGIATIDEILVGLFRDFQYVTEDRRTLAGKLYRMTRAGHLEGVPKRKGVWKVKE"
FT                   /protein_id="YP_003165179.1"
     MMSNDVLDKV GKRLGDLSDL PEALRKQINT GKMGDIEEKI LKTMRQRYDG IATIDEILVG        60
     LFRDFQYVTE DRRTLAGKLY RMTRAGHLEG VPKRKGVWKV KE                          102
//

If you have problems or comments...

PBIL Back to PBIL home page