(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE32

ACCPU_3.PE32         Location/Qualifiers
FT   CDS             38385..38675
FT                   /locus_tag="CAP2UW1_4600"
FT                   /gene_family="HOG000218314" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091537"
FT                   /db_xref="GeneID:8401972"
FT                   /translation="MTSRHEVKCINKTDRYNAHERIRAIGGVNPNGTNWKLTQEEAIRG
FT                   IEAGKWSFYVAVRGHIVNVIVAVSRFGNKYLKTEADGEQPNNLLSLYECVS"
FT                   /protein_id="YP_003165180.1"
     MTSRHEVKCI NKTDRYNAHE RIRAIGGVNP NGTNWKLTQE EAIRGIEAGK WSFYVAVRGH        60
     IVNVIVAVSR FGNKYLKTEA DGEQPNNLLS LYECVS                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page