(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE33

ACCPU_3.PE33         Location/Qualifiers
FT   CDS             complement(38918..39910)
FT                   /locus_tag="CAP2UW1_4601"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091538"
FT                   /db_xref="GeneID:8401973"
FT                   /translation="MARTSAVEYERVAEACSSLFLEGKSPSFESVYELIGRKGGAKVVQ
FT                   GMIADWRKEMANRFMAGRTNPDLPEELITESDKVLTVVWHLALEKSDAAYADERSRLGQ
FT                   ARVDMAAAVTQAQERAAEFEREALSLQGERQALQARLQGSQAEIEDLRQRLSDTTTLLR
FT                   ARDEQIGQMREDGARLANTLESERRNHEAELLAERDRHEQAVNAERQRAHESVEREREI
FT                   AAGERQYLMRQTDEIRQAAKANEAVLKEQLQEAKSFAESFQARAGRAESEAAFWRGKAE
FT                   AAAEESGRWQRASEEAAGKIDGLQGRIRILEHELAQRAPEESPTEKPAN"
FT                   /protein_id="YP_003165181.1"
     MARTSAVEYE RVAEACSSLF LEGKSPSFES VYELIGRKGG AKVVQGMIAD WRKEMANRFM        60
     AGRTNPDLPE ELITESDKVL TVVWHLALEK SDAAYADERS RLGQARVDMA AAVTQAQERA       120
     AEFEREALSL QGERQALQAR LQGSQAEIED LRQRLSDTTT LLRARDEQIG QMREDGARLA       180
     NTLESERRNH EAELLAERDR HEQAVNAERQ RAHESVERER EIAAGERQYL MRQTDEIRQA       240
     AKANEAVLKE QLQEAKSFAE SFQARAGRAE SEAAFWRGKA EAAAEESGRW QRASEEAAGK       300
     IDGLQGRIRI LEHELAQRAP EESPTEKPAN                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page