(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE35

ACCPU_3.PE35         Location/Qualifiers
FT   CDS             complement(40197..40511)
FT                   /locus_tag="CAP2UW1_4603"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091540"
FT                   /db_xref="GeneID:8401975"
FT                   /translation="MRVRLLDQAKNDLVALGQYYRDVGGDVLARKMVARIKTPVLSLKD
FT                   NPDIAPSYELAPGIRRLVVAKGAFLVFYRVRVDVEVLHIRRAARDSATGDELGQIATKE
FT                   "
FT                   /protein_id="YP_003165183.1"
     MRVRLLDQAK NDLVALGQYY RDVGGDVLAR KMVARIKTPV LSLKDNPDIA PSYELAPGIR        60
     RLVVAKGAFL VFYRVRVDVE VLHIRRAARD SATGDELGQI ATKE                        104
//

If you have problems or comments...

PBIL Back to PBIL home page