(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE36

ACCPU_3.PE36         Location/Qualifiers
FT   CDS             complement(40501..40926)
FT                   /locus_tag="CAP2UW1_4604"
FT                   /gene_family="HOG000254028" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091541"
FT                   /db_xref="GeneID:8401976"
FT                   /translation="MQNMTLEQFRATVESGGILSVVLKAQGAAFAIQAETQRGDAVLVD
FT                   TRRKLPRLFGDPRKALALLSEMGIKKAAVDTEAWRPEQADSLHPPRPDKSVKLKAAHEA
FT                   AELKRVLDERIAMADAQGAIWHEAEDVFDELVAAHAG"
FT                   /protein_id="YP_003165184.1"
     MQNMTLEQFR ATVESGGILS VVLKAQGAAF AIQAETQRGD AVLVDTRRKL PRLFGDPRKA        60
     LALLSEMGIK KAAVDTEAWR PEQADSLHPP RPDKSVKLKA AHEAAELKRV LDERIAMADA       120
     QGAIWHEAED VFDELVAAHA G                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page