(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE38

ACCPU_3.PE38         Location/Qualifiers
FT   CDS             41922..43115
FT                   /locus_tag="CAP2UW1_4606"
FT                   /gene_family="HOG000193597" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091543"
FT                   /db_xref="GeneID:8401978"
FT                   /translation="MTLPTPLPFPVEPARNQALSGPRLTAASTDHEAVATWLAKYTDNR
FT                   HTLDSYRREAERLMLWATWHGKDLPGLMVEDVLAYKAFLSDPQPVDLWCQQTEPRTLPD
FT                   GSPNPLCRQVRRVTRRLPDGSANPTWRPFVSGLSASAVKQTTTILFGLFEHLAAIGYVH
FT                   ANLLRAAAKRTRKGQRQGQERYFDAAAWAALTECIEAMPKETAREAAHYHRTRFLFSFL
FT                   YLTGLRRFEMARARTSDLRFKRGQWWLEVLGKGSVEGVVPLPADALEAIKSYRESTGRP
FT                   ALPPSGTDEPLLMDLTGAGRPLSDRAIYAIVKEVCRQAASSVAAAQPDLARQIDSGSTH
FT                   WLRHTSASHQIDRGVDPFIVQRNLRHASFSTTEGYIHKDRDQQHRETEKHTMIDAPS"
FT                   /protein_id="YP_003165186.1"
     MTLPTPLPFP VEPARNQALS GPRLTAASTD HEAVATWLAK YTDNRHTLDS YRREAERLML        60
     WATWHGKDLP GLMVEDVLAY KAFLSDPQPV DLWCQQTEPR TLPDGSPNPL CRQVRRVTRR       120
     LPDGSANPTW RPFVSGLSAS AVKQTTTILF GLFEHLAAIG YVHANLLRAA AKRTRKGQRQ       180
     GQERYFDAAA WAALTECIEA MPKETAREAA HYHRTRFLFS FLYLTGLRRF EMARARTSDL       240
     RFKRGQWWLE VLGKGSVEGV VPLPADALEA IKSYRESTGR PALPPSGTDE PLLMDLTGAG       300
     RPLSDRAIYA IVKEVCRQAA SSVAAAQPDL ARQIDSGSTH WLRHTSASHQ IDRGVDPFIV       360
     QRNLRHASFS TTEGYIHKDR DQQHRETEKH TMIDAPS                                397
//

If you have problems or comments...

PBIL Back to PBIL home page