(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE39

ACCPU_3.PE39         Location/Qualifiers
FT   CDS             43324..43896
FT                   /locus_tag="CAP2UW1_4607"
FT                   /gene_family="HOG000158240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091544"
FT                   /db_xref="GeneID:8401979"
FT                   /translation="MIAYGGPLSVSQLAHECCLSRQGTYQTLNSLVSQRLVRVLGQARS
FT                   QLFTMDTNHPLSPGLKELFGHEQCRWDELLQVLRDTFQTNKDIHAAWYYGSVARGEDEP
FT                   HSDLDIAVIAPDGRVDETVESVRQALREVEDRLYISCSIVGLSPSDVMRLSSGDDWWQN
FT                   MARDAKVLKGVGPEPYAATLIRQRMKA"
FT                   /protein_id="YP_003165187.1"
     MIAYGGPLSV SQLAHECCLS RQGTYQTLNS LVSQRLVRVL GQARSQLFTM DTNHPLSPGL        60
     KELFGHEQCR WDELLQVLRD TFQTNKDIHA AWYYGSVARG EDEPHSDLDI AVIAPDGRVD       120
     ETVESVRQAL REVEDRLYIS CSIVGLSPSD VMRLSSGDDW WQNMARDAKV LKGVGPEPYA       180
     ATLIRQRMKA                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page